KEGG   Bacteroides fragilis YCH46: BF0381Help
Entry
BF0381            CDS       T00202                                 

Definition
beta-hexosaminidase precursor
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BF0381
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BF0381
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BF0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(443379..444914)
Genome map
AA seq 511 aa AA seqDB search
MKRTNRTLFIHNTARGRIKFLLLALFAFQGLQAQKLFPAPSAIETHKGTFSYDEVSAKCV
RTTISKSLPAIGIEYSDEAYQLEITPDSIFIDATSAKGAFYARQAIKQLARHERGKIRCC
RIYSSPRYAWRGFMLDESRHFFGKEKVKQYLDLMALLHLNVFHWHLTDEPGWRIEIKKYP
KLTKIGAVGNWHDAQAAPQFYTQDDIREIVAYAAERQIMVVPEFDMPGHATAVCRAYPEV
SGGGEGRWKHFTFHPCKEETYRFISDVLDEIAALFPAPYIHVGGDEVHYGNQNWFTDPEI
QNFIKEKGLINETGLEHYFIRRAADLVAAKGKKMIGWDEIVDAGISPSKALVMWWRHDRK
YQLLKALEQGYQVVLTPRRPLYGDFVQDASHKVGRYWDGFNPLQDIYAFPEPISHLFKGY
EDQILGMQFTLWTERIADGKRLDFMTFPRLIALAESAWTSPKEKDWSRFCMRLPSFLEYL
KEQGIYYFDVIHPQETPEPGGPEKADVLQNG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaccaacagaacattattcattcataatacagcaagagggagaataaaattt
cttcttcttgctctatttgcttttcaaggcttacaagcacaaaagctattccccgctcct
tctgcgatagagacacataaaggtacattctcttatgacgaagtttcggctaagtgtgta
cgaactactatctctaagtctctacctgctatcggcatagaatactcggatgaagcatat
caactggaaattacaccggattctatcttcattgatgccacttctgcgaaaggagcattt
tatgcccgccaagccattaaacaactggcacggcacgaacggggcaaaatccgctgttgc
cggatttacagttcgccacgctacgcatggcgcggatttatgctcgatgaaagccgccac
ttcttcggtaaagagaaagttaaacaatacctcgacttaatggctttactccatctcaat
gtattccactggcatctgacagacgaaccgggatggcgaattgaaatcaaaaaataccct
aagctgacgaaaataggggccgttggcaattggcatgatgcccaagcagctccgcagttc
tatacacaggacgatatacgagagattgtggcttatgcggccgaacgccagattatggtg
gttcctgaattcgatatgcccggacatgccacagcggtctgccgcgcttatcccgaagta
tcgggcggaggagaaggacgctggaagcatttcacattccatccttgcaaagaagaaact
tatcgttttatcagcgatgtactcgatgaaatagcagccctcttcccggctccctatatc
catgttggaggtgatgaagtgcactacggcaatcagaactggttcactgatcctgaaatc
cagaacttcataaaggaaaaagggctgatcaatgaaaccggactggagcattacttcatc
cgccgtgctgccgatctggtagcggccaaaggtaaaaaaatgattggttgggacgaaata
gtggacgccggtatctccccctccaaagcgttggttatgtggtggcgccacgaccgtaag
taccagttgctgaaagcgcttgagcaaggctatcaggtagtcctgactccacgtcgcccg
ctgtatggcgatttcgtacaggatgcctcacataaagtgggacgctattgggatggattc
aatccgttgcaagacatatatgccttccccgaaccgatcagtcatctttttaaaggatac
gaagatcagatactgggtatgcagttcacactttggaccgaacggattgcagacggaaaa
cggttggacttcatgaccttcccacgcctgatagcactggcagaatctgcgtggacatcg
cccaaagagaaagactggagtcgtttctgcatgcggttaccgtctttcctggaatatctg
aaggagcaaggcatctattatttcgatgtgattcacccacaagaaactcccgaaccgggc
ggaccggagaaagcggacgtattacaaaacggatag

DBGET integrated database retrieval system