KEGG   Bacteroides fragilis YCH46: BF0455Help
Entry
BF0455            CDS       T00202                                 

Definition
putative glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BF0455
   00330 Arginine and proline metabolism
    BF0455
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BF0455
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BF0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536141..537106
Genome map
AA seq 321 aa AA seqDB search
MDKKISISQIKEVVQQAYEQVKGNTGGKNADYIPYLANIDKNLFGISVCLLNGQTITVGD
FDYRFGIESVSKVHTAILILRQYGAQKVLEMIGADATGLPFNSIIAILLENDHPSTPLVN
AGAISACSMVTPIGNSDKKWDAIVQNITDLCGSAPQLIEELYKSETATNFNNRSIAWLLK
NYNRIYDDPNMSLDLYTRQCSLGVTAQMLSVAAGTVANGGVNPVTKKQVFDSELTPKITS
MIATVGFYEHSGDWMYTSGIPAKTGVGGGVMGVLPGVFGVSAFAPPLDGSGNSVKAQLAI
KYIMNKLGLNVFNGARVTIVD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaaatatctatttcccaaataaaagaggttgtgcagcaggcctacgaacag
gtaaaaggtaatacaggcggtaagaatgccgattatattccttatctggccaatatagac
aaaaacctttttggtatcagtgtctgcctgctgaacggtcagaccattaccgtgggtgac
tttgattatcgtttcggtatcgaatccgtatctaaagtgcatacagccattctgattctc
cgccaatacggggcacagaaagtgcttgagatgatcggtgcggatgctaccggacttcct
tttaactctatcattgccatcttgttggagaatgaccatccgtctactccgttggtaaat
gccggagccatctcagcttgttccatggtgactccgattggtaattcagataagaaatgg
gacgccatcgtacagaacattaccgatctttgcggttctgctccacagttgatcgaagaa
ctctataagtcggagacagctaccaatttcaataaccgttctattgcctggttactgaag
aactataatcgtatctatgacgatcccaatatgtcactggacctttatactcgccagtgc
tctttgggggtaactgcacagatgttgtcggtggctgccggtacggttgccaatggcggt
gtgaatcctgtgactaaaaagcaggtgttcgattccgaactgactcctaaaatcacatct
atgattgctaccgtaggcttctacgaacattcgggcgactggatgtatacttcaggtatt
cctgccaagaccggtgtaggtggtggtgtgatgggagtattgccgggtgtattcggtgta
tctgcctttgctcctcctttagatggctcgggcaactcggtgaaagcacagttggccatt
aagtacatcatgaacaaattgggattgaatgtattcaatggtgcgagagtgaccatcgtc
gattag

DBGET integrated database retrieval system