KEGG   Bacteroides fragilis YCH46: BF0457Help
Entry
BF0457            CDS       T00202                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
539319..540179
Genome map
AA seq 286 aa AA seqDB search
MDSTIFKSLNVNGRLLDLSIPQVMGILNVTPDSFYAGSRSRTEADIAARARQILDEGASM
IDIGAYSSRPNAEHISPEEEMRRLRTGLEILNRNHPGAIISVDTFRAGVAEECVKEYGVA
IINDISAGEMDEQMFPTVARLNVPYIMMHMQGTPQNMQKEPHYENLLKEVFIYFARKVQQ
LRDLGVKDIILDPGFGFGKTLEHNYELMAHLEEFGIFELPLLVGVSRKSMIYRLFGTTPQ
EALNGTTVLDTVALMKGADILRVHDVREAVESVRLIEKLKSVSACS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggattcaacgattttcaaaagtctgaatgtgaacggtcgtttacttgatctttccatt
ccgcaggttatgggtatactcaatgttacacccgattctttttatgcaggtagccgaagc
cggacagaagccgatattgccgcacgtgcccgtcagatacttgatgaaggggcctctatg
attgatataggagcttattcgtcacgtccgaatgccgaacacatctcgcccgaagaagaa
atgcggcgtttgcgtaccggtctggaaatattgaaccggaatcatccgggtgctatcatt
tcagttgacacattccgtgccggagtggctgaggaatgcgtgaaggagtacggagtggct
attatcaatgacatttcggccggtgagatggacgaacagatgtttccgacggtggcccgc
ctgaatgtaccttacattatgatgcacatgcaaggtactcctcaaaacatgcaaaaggag
ccccattatgaaaatttgctgaaagaggtcttcatctattttgcccggaaagtacagcaa
ttgcgtgacttgggagtgaaagacattattctcgatcccggtttcggcttcggcaaaacg
ttggagcataactacgaactgatggcgcatctggaagagttcggcattttcgaacttccc
ttgttggtgggagtttcccgcaagtcgatgatttatcgtttgtttggaaccacaccgcag
gaagcactcaacgggacaacagtactcgatacggtagctttgatgaaaggtgccgatatt
ctccgtgtgcatgatgtgcgtgaagctgtcgagtcggttcggctgatagagaaattaaaa
agtgtatcggcttgttcctga

DBGET integrated database retrieval system