KEGG   Bacteroides fragilis YCH46: BF0528Help
Entry
BF0528            CDS       T00202                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00010  Glycolysis / Gluconeogenesis
bfr00620  Pyruvate metabolism
bfr00640  Propanoate metabolism
bfr00680  Methane metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
bfr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF0528
   00620 Pyruvate metabolism
    BF0528
   00640 Propanoate metabolism
    BF0528
  Energy metabolism
   00680 Methane metabolism
    BF0528
Enzymes [BR:bfr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BF0528
Lipid biosynthesis proteins [BR:bfr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BF0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 3082295
NCBI-ProteinID: YP_097811
UniProt: Q64YZ9
Position
complement(604185..605840)
Genome map
AA seq 551 aa AA seqDB search
MIDRFLSQTSFSSQEDFVKNLKIHVPDNFNFGYDIVDAWAAEQPDKPALLWTNDKGEHHQ
FSFADMKQYTDRTASYFQSLGIGHGDMVMLILKRRYEFWFSIIALHKLGAVVIPATHLLT
KKDIVYRCNAADIKMIVAAGEEVVTKHIIDAMPDSPTVKHLVSVGPEIPEGFDDFHQGIE
HAAPFVKPEHPNTNDDISLMYFTSGTTGEPKMVAHDFTYPLGHIVTGSFWHNLKENSLHL
TIADTGWGKAVWGKLYGQWIAGANVFVYDHEKFTPADILEKIQNYHVTSLCAPPTIFRFL
IHEDLTKYDLSSLEYCTIAGEALNPAVFDTFKKLTGIKLMEGFGQTETTLTVATFPWMEP
KPGSMGVPNPQYNVDLIDYEGRSVEAGEQGQIVIRTDKGKPLGLFKEYYRDASRTHEAWH
DGIYYTGDVAWKDEDGYLWFVGRADDVIKSSGYRIGPFEVESALMTHPAVVECAITGVPD
EIRGQVVKATIVLAKEYRERKGEDLVKELQNHVKKVTAPYKYPRVIEFVDELPKTISGKI
RRVEIRKNDEK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgatagatagatttttatctcaaacttccttcagttcacaggaagactttgtgaaaaac
ttaaagatacacgttccggacaacttcaacttcggatatgacatagtggatgcttgggct
gccgaacaaccagacaaaccggccttattatggactaatgacaaaggtgaacaccaccag
ttctcttttgcggatatgaaacaatatactgaccggacagcctcttattttcagagcctg
ggtatcggacatggtgatatggtcatgctgatattgaaacgacgctatgaattctggttc
agcatcattgccctgcacaaactaggggcagtcgttattccggctacacacctgctaacc
aagaaagacattgtataccgttgcaatgcagccgacataaaaatgattgtggctgccgga
gaagaagtggtcaccaaacacataatagatgctatgccggactctcctactgtaaagcat
ttagttagcgtagggcccgaaatacccgaaggatttgatgacttccatcagggcattgag
catgcggcgcctttcgtaaagccggaacatccgaacaccaacgatgacatttcactgatg
tacttcaccagcggaacaaccggagagcctaagatggttgcacacgacttcacttatcca
ttggggcatatcgtaaccggtagtttctggcacaatctgaaagaaaacagcctccatctc
accatcgccgacaccggctggggaaaagcagtgtggggaaagctctacggacaatggatt
gccggagcaaatgtattcgtgtatgatcatgaaaagttcactcctgccgatatattggaa
aagatacaaaattaccatgtcacttcactctgtgcccctcccaccattttccgtttcctc
atccacgaagacctgacgaaatatgacctttcgtcattggaatattgcaccattgcaggt
gaggccttgaatccggctgttttcgacacattcaaaaagttaacaggcatcaaactgatg
gaaggcttcggacagaccgagactacactgacagtagccactttcccatggatggaaccc
aaaccgggaagtatgggggtgcccaatccacaatacaatgttgatctgatcgattacgaa
ggacggtcggtagaagccggagagcaaggacagatcgtaatccggactgacaaaggaaag
ccactgggactgttcaaagaatactatcgggacgcctcgcgtacacacgaagcatggcac
gacggaatatactacactggcgacgtagcctggaaagatgaagacggttatctatggttc
gtgggacgcgccgatgacgtaatcaaaagttccggttaccgcatcggtccgttcgaagtg
gaaagtgcattgatgacacatcccgccgtagtagaatgtgccataaccggcgttcccgac
gaaatacgcggacaggtagtgaaagctaccatcgttctggccaaagagtatcgtgaacgc
aaaggggaagacctggtaaaagagctccagaatcatgtgaagaaagtcacagctccttat
aaatatccacgcgtcatcgaatttgtcgacgaattgcctaagaccattagcggtaaaatc
cgacgagtggaaattcggaagaatgacgagaaataa

DBGET integrated database retrieval system