KEGG   Bacteroides fragilis YCH46: BF0550Help
Entry
BF0550            CDS       T00202                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BF0550
  Lipid metabolism
   00561 Glycerolipid metabolism
    BF0550
   00600 Sphingolipid metabolism
    BF0550
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BF0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(627274..629442)
Genome map
AA seq 722 aa AA seqDB search
MLKRTFILICLVLSFCSLPAQELIQVTTRNTALVFRVANQSLRQVYYGPRLADTDVLQKQ
GNNFPAYSTYGMGEQNEVALHAVHADGNTSTLLNFESVKQESPEPGITLTTISLKDPLYP
FQVKLFYKAYEESDLIEQWTIYQHTEKKPVTLYQFASAQLSFKSSSYRLTHFAGDWAGEC
NMSEVELTEGIKVIDSKLGTRATFFAHPMCLLSLNGRMTEDNGEVIGMALAWPANFKLEF
EKNNNQELRVLAGMNPYASHYKLKKGDVFQTPSFLYTYSTKGNGQVSRNFHRWARKYGLR
HGENSRYTLMNNWEATYFNFNEPKLKSIIEDAAGMGFELFLLDDGWFGQKHPRNNDDAGL
GDWVVNKEKLPNGLGWLVKQCTDNDIKFGIWVEPEMVNPQSELFEKHPDWVIQQPGREHI
LFRRQLVLDLSNPEVQEFVYKSVHDILKDNPQIAFVKWDCNRAVTNPGSTYLPADEQSHI
WIEYGRGLLNVFKKVRDSHPDVHFMLCSGGGGRLDYGSLRYFEEYWPSDNTDALQRILIQ
WGNSQFFPSIAMCCHVSASPNHQTGRTTPLKFRFDVAMQGALGMDLQPSTMNEKEVIFAK
EAIKTYESIRNIVFTGDLYRILSPYEGNRTSMMYVLPDKSRAVFYAYQLKSHIGEVSAPM
RFKGLSPDKKYNVKELNIYPGSRAATGSANGQSFSGDFLMNQGLPIGLSGDYSSAVIELE
QQ
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaagaacatttatattaatctgccttgtcctgagtttttgttcactgccagcg
caagaactgattcaggttacgacacgcaacacagcacttgttttcagggttgccaatcaa
tcactaagacaagtttattatggcccacgcctggcagacaccgatgtattacagaaacag
ggcaataactttccggcatattcgacttatggaatgggagaacaaaacgaagtggccctt
catgcagtacatgcagacggtaatacctctacactactgaactttgaaagcgtgaaacaa
gagtctccggaacccggcataacactgactacgatttcactgaaagacccgctatatcct
tttcaagtgaaacttttctataaggcatacgaagagagcgaccttatagaacaatggact
atatatcagcatactgaaaagaaaccggtaacactttaccagtttgcttccgcacagctc
tcctttaaatcttcctcctaccgactcactcactttgccggtgactgggccggagaatgc
aacatgagtgaagtagaactgacagaaggcatcaaagtgatagattccaaattaggaacc
cgtgccacattctttgctcatcccatgtgtctgctatccctgaacggacggatgactgaa
gacaatggagaagtgatagggatggctctggcatggcctgccaactttaagttggaattt
gaaaaaaacaacaatcaggaactccgtgtacttgccggaatgaatccgtacgcatcacac
tacaaacttaaaaaaggagatgtattccaaactccttcgttcctctacacatacagtaca
aaaggaaacggacaggtcagtcgtaatttccaccgttgggcacgtaaatatggtttacgc
cacggagaaaattcacgttataccctgatgaacaactgggaagccacttacttcaacttt
aacgaacccaaactgaaatcaattatagaagatgctgcagggatgggcttcgaactcttc
ctgctggacgacggatggtttggacagaaacatccccgcaacaatgatgacgcaggactt
ggcgactgggtggtaaacaaagaaaaacttcccaacggactgggatggctggtaaaacaa
tgtacggataatgatatcaagttcggtatctgggtggaacctgaaatggtaaacccccaa
agtgaactattcgaaaaacatcctgactgggtaatccagcaaccgggacgtgaacatatt
ctctttcgccggcaactggtactcgacctatcgaatcccgaagtacaagagtttgtatat
aagagtgtacacgacattctgaaagataaccctcagatagcttttgtgaaatgggactgt
aaccgtgctgtaaccaacccgggatccacttatttacctgccgacgaacagtcacacata
tggatcgaatacggacggggattactgaatgtttttaagaaagtacgcgattcacatccc
gacgtacactttatgctttgttctggtggaggaggccgtctggattacggttcactgcgc
tacttcgaggaatactggcccagcgataataccgatgccttgcaacgtatccttattcaa
tggggcaattcacagttctttccctcgatagcaatgtgttgccatgtttctgccagtccg
aatcatcagaccgggcgcactactccactgaaattccgctttgacgtagctatgcaggga
gctttgggaatggatttacaaccgtccaccatgaatgaaaaagaagtaatctttgccaaa
gaggctatcaagacttacgaaagtatccgtaacatagtgtttacaggcgacctgtaccgt
attttatctccttacgaaggtaaccgcacctccatgatgtatgtattgccggacaagagt
cgtgccgtattctatgcttaccaattaaaatcacatatcggtgaagttagtgctccgatg
cgtttcaaaggtctgagtcccgacaagaaatacaacgtgaaagaattgaacatctatccg
ggaagccgtgctgcaacagggtcagccaacggacaatctttcagtggcgatttcctgatg
aatcaaggcttgcctattggtttatccggtgattacagtagcgctgtcattgagttggaa
cagcagtag

DBGET integrated database retrieval system