KEGG   Bacteroides fragilis YCH46: BF0610Help
Entry
BF0610            CDS       T00202                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BF0610
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF0610
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BF0610
Enzymes [BR:bfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BF0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
720387..721688
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQAPLASLEEAVVKGLASDKGLFMPMTIKPLPQEFYDEIENLSFREIAYRVAD
AFFGEDVPAETLKEIVYDTLNFDVPLVPVKENIYSLELFHGPTLAFKDVGGRFMARLLGY
FIRKEGRKQVNVLVATSGDTGSAVANGFFGVEGIHVYVLYPKGKVSEIQEKQFTTLGRNI
TALEVDGTFDDCQALVKAAFMDQELNERLLLTSANSINVARFLPQAFYYFYAYAQLKKAG
RAENAVICVPSGNFGNITAGLFGKKMGLPVRRFIAANNKNDIFYQYLQTGQYNPRPSVAT
IANAMDVGDPSNFARVLDLYGGSHAAIAAEISGTTYTDEQIRESVKACWQQTGYLLDPHG
ACGYRALEEGLQPGETGVFLETAHPAKFLQTVESIIGTEVEIPAKLRAFMKGEKKSLPMT
KEFADFKSYLLGK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatagtactaacaaacaagctccgcttgcttcgcttgaagaagcggtagtc
aaaggacttgcttctgataaggggctattcatgcccatgaccatcaaacccttgcctcaa
gagttttatgacgagatagagaatctttctttccgggaaatcgcttaccgggtggcagat
gctttctttggagaagatgttccggcggaaacgctgaaagagatcgtttatgatacgttg
aattttgatgtcccgttggtgccggtgaaggagaacatctattccctggagcttttccac
ggtcctacattggcttttaaagatgtaggtggacggtttatggcccgtttgttgggatac
ttcatccggaaagaggggcggaaacaggtgaatgtgctcgttgccacttccggagatacc
ggtagtgcggtagccaatggcttttttggggtagagggtattcatgtgtacgtgctctat
ccgaagggaaaagtcagcgagatacaggaaaaacagttcactacgctggggcggaatatt
acagccctggaggtggacggaacgtttgacgactgccaggcgctggtgaaagcagccttt
atggatcaggaactgaacgaacggttgttgctgacctcggctaactctatcaacgtggca
cgtttcctgccgcaggcattctattacttttatgcctatgcgcaattgaagaaggccggc
cgggcagagaatgccgtcatctgtgtgccgagcggaaactttggtaacattactgcaggc
ttgttcggcaaaaagatgggcttgcccgtccgccgttttatcgccgccaacaataagaat
gatattttctatcaatatttgcagacaggacagtacaatccccgtccgtccgttgccacc
attgccaatgcgatggatgtgggtgatccgagcaactttgcccgtgtgctcgacctgtat
ggcggttcgcatgcagccatcgctgccgagatatccggaacgacgtacaccgacgagcag
attcgtgaaagcgtgaaagcgtgctggcagcagacgggttatctgctcgatcctcatgga
gcatgcggttaccgtgcattggaggaaggcttgcagccgggtgagacaggcgtcttcctc
gaaacggcccatccggccaaattcctgcaaacggtggagagcatcattggtaccgaggtc
gaaatacctgctaagctccgggcttttatgaaaggcgaaaagaaaagtttgccgatgacg
aaggagtttgctgatttcaagagctatctgctgggcaagtag

DBGET integrated database retrieval system