KEGG   Bacteroides fragilis YCH46: BF0929Help
Entry
BF0929            CDS       T00202                                 

Definition
(RefSeq) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00052  Galactose metabolism
bfr00511  Other glycan degradation
bfr00600  Sphingolipid metabolism
bfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BF0929
  Lipid metabolism
   00600 Sphingolipid metabolism
    BF0929
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BF0929
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BF0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 Fn3-like
Motif
Other DBs
NCBI-GeneID: 3082753
NCBI-ProteinID: YP_098214
UniProt: Q64XU6
Position
complement(1105980..1109315)
Genome map
AA seq 1111 aa AA seqDB search
MKLRLSDTLNSLMLGGLLMASTFASADNKPTKPYWQDVQVVAVNKEYPRSSFMTYENRAN
ALTGKFEKSKYYQLLNGTWKFYFVDSYKNLPANITDPAISTADWADIKVPGNWEVQGHGV
AIYTNHGYEFQPRNPQPPTLPEANPVGVYRRDIDIPADWDGRDIYLHLAGAKSGVYVYIN
GQEVGYSEDSKNSAEFLINKFVKPGKNVLTLKIYRWSTGSYLECQDFWRISGIERDVFLY
SQPKAALKDFRVTSTLDDTYKDGIFKLGVDLRNNGSTAGNMTLVYELLDANGKVVATGEK
ATNVAAGETRTVSFDQTLPDVKTWSSEAPNLYKLVMTVKENGKVNEIIPFNVGFRRIEIK
PTEQLARNGKPYVCLFINGQPLKLKGVNIHEHNPATGHYMTEELMRKDFELMKQHNLNTV
RLCHYPQDRRFYELCDEYGLYVYDEANIESHGMYYDLAKGGTLGNNPEWLKAHMDRTINM
FERNKNYPSLTFWSLGNEAGNGYNFYQTYLWVKNADKDIMNRPVNYERAQWEWNSDMYVP
QYPGADWLEAMGKRGSDRPIVPSEYSHAMGNSNGNLWDQWKAIYKYPNLQGGYIWDWVDQ
GIDAVDENGRHFWTYGGDYGVNTPNDGNFNCNGIVSPDRTPHPAMAEVKYVHQNVAFEAV
DPANGKFLVKNRFYFTNLQKYMISYTIKANGKTVKGGKMSVNVEPQGSKEITIATSGLKS
KPGTEYFIYFNVTTTEPEPLIPVGHEIAYEQFRLPIEPGERTFATGGPALKVSAEGNELT
ASSSKVNFVFDKKTGLVSSYKVGGTEYFKDGFGLQPNFWRAPNDNDYGNGNPKRLQVWKQ
SSKNFNVVDANIVMDGKDAVLTANYLLAAGNLYIVTYRISPSGVVKADFTFTSTDMEAAK
TEASEATLMATFTPGSDAARKAASKLEVPRIGVRFRLPAEMNQVEYFGRGPEENYIDRNA
GTLIDLYKTTADQMYFPYVRPQENGHHTDTRWLTLNKKGGKGLTIYADKTIGFNALRNSV
EDFDGEETVSRPYQWLNRDAGELVHDENKAKDQLPRKTHINDITPRNFVEVCVDMKQQGV
AGYNSWGARPEPGYNIPANQEYKWGFTIVPK
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaagactatctgacaccttaaatagccttatgttgggtggcctcctgatggca
tccacctttgcttcggccgacaacaaaccgacgaaaccttactggcaggacgtacaggtg
gtagccgtaaataaagaatacccccgttcttcatttatgacctacgaaaaccgcgcaaac
gccctgaccggaaagtttgaaaaaagcaagtactaccaactcctgaacggcacctggaag
ttctattttgtagattcatacaagaacctgccggccaacatcaccgaccctgcaatcagt
acagccgattgggcagacatcaaagtaccgggcaactgggaagtacaaggccacggagta
gctatttataccaaccacggatatgaattccagccccgtaaccctcaacctcctactttg
ccggaagccaatccggtaggtgtttaccgcagggacatcgatattcccgccgactgggac
ggacgcgatatttacctccatctggccggtgccaaatcgggtgtatacgtatatatcaac
ggacaggaagtaggttacagcgaggactctaaaaacagtgcggagttcctgatcaataaa
ttcgtgaagcccggcaaaaatgtccttactttaaagatttaccgctggagtaccggatcc
tatctggaatgccaggacttctggcgtatcagcggtatcgaacgcgatgtattcctttac
tcacaacccaaagccgcgctcaaagatttccgtgtaacatcgactctggacgatacatac
aaagacggtatcttcaaactgggcgtagacctgagaaacaacggttcgacagccggcaat
atgacgttggtatacgaactgctcgatgccaatggcaaagtagtggcaaccggagagaaa
gcaactaatgtagcggccggagagacccgtacggtgtctttcgaccagacacttccggat
gtaaagacctggagttcggaagcccccaacctctacaagttggtgatgacagtaaaagaa
aacggtaaagtgaacgagatcattccgttcaacgtaggtttccgccgcatcgaaattaaa
ccgaccgagcaactggcacgcaacggaaagccctatgtatgcctcttcatcaacggacag
ccgctgaagctgaagggagtgaacattcacgaacataaccctgctaccggtcactatatg
actgaagagttgatgcgcaaagatttcgaattgatgaaacaacacaacctgaatacggtt
cgcctgtgccattatccgcaagatcgccgtttctacgaattgtgcgacgaatacggactt
tatgtatacgatgaagcaaacatcgagagccatggcatgtactatgatcttgctaaaggc
ggtacgctgggaaacaatccggaatggttgaaagcgcacatggaccgcacaatcaacatg
ttcgaacgtaataagaactatccgagtctgactttctggtcgctgggtaacgaagccggc
aacggttataacttctaccagacttacctttgggtcaagaatgccgataaagacatcatg
aaccgtccggtcaactacgaacgtgcccaatgggaatggaactccgatatgtatgttccg
caatatccgggtgccgactggctggaggcaatgggcaaacgcggcagtgaccgcccgatt
gttccttctgaatattcacatgccatgggtaactcaaacggtaacctttgggatcaatgg
aaagcaatctataaatatccgaacctgcagggtggatacatttgggattgggtagaccag
ggcattgacgcagtagacgaaaacggacgccacttctggacatacggtggtgactatggg
gtaaacactccgaacgacggtaactttaactgtaacggtattgtaagtccggaccgtact
ccgcatccggctatggccgaagtgaagtatgttcaccagaacgtggctttcgaagcggtg
gatccggctaatggaaaattcctggtcaagaatcgtttctacttcacgaacctgcagaag
tatatgatctcatataccattaaggccaatggcaaaacagtgaaaggcggcaaaatgtct
gtcaatgtggaaccgcagggaagcaaagaaatcacgatcgcgacaagcggactgaaatca
aaacccggaactgagtattttatatacttcaacgtaacgactaccgaaccggaaccgtta
atccccgttggacatgaaatagcatacgaacagttccgtctgcctatcgaaccgggcgaa
cgtactttcgctaccggtggtccggctctgaaagtatcggcagaaggcaatgaactgaca
gcgtcttcttcaaaagtaaacttcgtattcgataagaagaccggtctggtttcttcctat
aaggtaggtggaaccgaatactttaaagatggcttcggacttcagccgaacttctggcgt
gcaccgaacgacaacgactatggcaatggtaaccccaaacgcctgcaagtatggaaacag
tcgagcaaaaacttcaatgtagtggacgccaacatcgttatggacggcaaagatgccgta
ttgacagctaactatctgctggctgccggcaacctttacattgttacataccgcatctct
ccttcgggcgtagtaaaagccgatttcactttcacttctaccgatatggaagctgccaaa
accgaagcctcggaagcaaccctgatggctactttcactcccggcagcgatgcagcgcgc
aaggctgcctccaaactggaagtaccccgtatcggtgtacgtttccgtctgcctgcagaa
atgaaccaagtggaatatttcggacgcggaccggaagaaaattatatagaccgcaatgcg
ggtacattgatcgacctgtataaaacgactgccgaccaaatgtacttcccatacgtacgt
ccgcaggaaaacggacaccataccgatacccgttggttgaccctgaataaaaaaggcggt
aaaggactgactatttatgcagacaagactatcggtttcaatgcactgcgcaattcggta
gaggactttgacggagaagaaaccgtatcccgcccctatcaatggctgaaccgtgatgcc
ggcgaattggttcacgacgaaaacaaagccaaagatcaactgccgagaaagacacatatc
aatgatatcacaccaaggaacttcgtagaagtatgtgtggacatgaagcaacagggcgta
gccggttacaacagttggggtgcacgtccggaaccgggttacaatattccggcaaaccag
gaatataaatggggattcacaatcgtaccaaaataa

DBGET integrated database retrieval system