KEGG   Bacteroides fragilis YCH46: BF1290Help
Entry
BF1290            CDS       T00202                                 

Definition
(RefSeq) putative zinc-type alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00010  Glycolysis / Gluconeogenesis
bfr00071  Fatty acid degradation
bfr00350  Tyrosine metabolism
bfr00625  Chloroalkane and chloroalkene degradation
bfr00626  Naphthalene degradation
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
bfr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF1290
  Lipid metabolism
   00071 Fatty acid degradation
    BF1290
  Amino acid metabolism
   00350 Tyrosine metabolism
    BF1290
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BF1290
   00626 Naphthalene degradation
    BF1290
Enzymes [BR:bfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BF1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Shikimate_DH Glu_dehyd_C TrkA_N DAO
Motif
Other DBs
NCBI-GeneID: 3081368
NCBI-ProteinID: YP_098574
UniProt: Q64WT6
Position
1526390..1527430
Genome map
AA seq 346 aa AA seqDB search
MLAYTYVEHGKFELLEKLRPQIKDARDVIVRVTLGSICTSDLHIKHGSVPRAVPGITVGH
EMVGIVEEVGSGVISVRPGDRVTVNVETFCGECFFCRHGYVNNCTDPDGGWALGCRIDGG
QAEYVRVPYAEQGLNRIPDNVSDEQALFVGDVLATGFWATRISEISEDDTVLIIGAGPTG
ICTLLCVMLKKPRRIIVCERSAERIRFVREHYPDVLVTEPENCRDFVLCNSDHGGADVVL
EVAGSEETFRLAWECARPNAIVTIVALYDKPQFLPLPDMYGKNLIFKTGGVDGCDCAEIL
SLIEQGRIDTTPLITHRFPLNEIEEAYRIFENKLEGVIKIAITGGR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcatatacatatgtcgaacatgggaagtttgaacttttggagaagttgaggcca
caaataaaagatgcccgggatgtaatcgtacgtgtaacacttggcagtatctgcaccagt
gatcttcatattaaacatggcagtgttccgcgtgcagttcctggtattacagtcggccac
gagatggtgggcattgtggaggaagtaggctccggcgtcatttccgtcagacccggtgat
agagtgacagtcaatgtcgaaaccttttgtggagaatgtttcttttgtcggcacggatat
gtgaacaactgtactgaccccgacggaggatgggcattaggttgccgtattgatggcgga
caggcggaatatgtcagggttccgtatgccgagcagggattgaatcgtattcccgataat
gtcagtgatgaacaagctctgtttgtaggtgatgtgcttgcaacggggttctgggctacc
cgcatttcggagatatccgaagatgatacggttttgattataggtgccggccctaccgga
atctgtactttgctctgtgtgatgttaaagaagccacggcgcattattgtttgtgaacgg
tctgctgagagaatccggtttgttcgtgaacattatcctgacgtgctggtgacagaacct
gaaaactgtagggattttgtactctgcaacagcgatcatggtggagcggatgtcgtgttg
gaagtggcgggttccgaagaaactttccgtctggcgtgggagtgtgcccgccccaatgcc
atcgttaccatcgtagccctttatgacaaacctcagtttttacctttgcccgatatgtat
ggcaagaacttgatcttcaaaacaggtggggtagatggttgcgattgtgccgagattctc
agtctgattgagcaaggcaggatagacactactcctcttattacgcataggtttccgttg
aacgaaatagaggaagcttatcgtatctttgaaaacaagctggagggagttatcaagata
gctataacgggaggcaggtag

DBGET integrated database retrieval system