KEGG   Bacteroides fragilis YCH46: BF1655Help
Entry
BF1655            CDS       T00202                                 

Definition
(RefSeq) aldose 1-epimerase precursor
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00010  Glycolysis / Gluconeogenesis
bfr00052  Galactose metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF1655
   00052 Galactose metabolism
    BF1655
Enzymes [BR:bfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BF1655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 3081126
NCBI-ProteinID: YP_098937
UniProt: Q64VS3
Position
complement(1920250..1921347)
Genome map
AA seq 365 aa AA seqDB search
MINTFPTEGNRSGLSRKDFQKDINDKKTDLFILKNKKGMEVAVTNYGCAILSIMVPDKDG
KYANVVLSYGTLDALMHGPEPFLSTTIGRYGNRIAKGKFTLYGEEHSLTINNGPNSLHGG
PTGFHARVWDAEQLEEGVIRFNYTSADGEEGFPGNLEVEMTYRLEEEENAIVIEYRATTD
KATVVNLTNHGFFNLAGTANPTPTVENNIVTINADFYTPIDEVSIPTGEIAKVEGTPMDF
RTPHTVGERINDKFQQLIYGAGYDHCYVLNKAETGSLDLAATCKEPNSGRTMEVYTTEAG
VQLYTGNWLGGFEGTNGATFPARSAICFEAQCFPDTPNKAHFPSATLLPGDEYQQVTIYK
FGVEK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgattaacacattcccaactgaaggaaatcggtcagggctcagccggaaagattttcaa
aaggatataaacgataagaaaaccgatttgtttatcctcaaaaacaagaaaggaatggaa
gttgccgtaacaaactacggatgcgccattctatctatcatggttccggataaagacgga
aaatatgccaatgttgtactcagctatggtacactggatgcactgatgcacggaccggaa
cctttcttaagtaccactatcggacgttatggcaatcgcatcgccaaaggtaaattcacc
ctgtatggcgaagaacatagtctcacgatcaacaacggtcccaactcacttcatggtggc
cccaccggatttcacgccagagtatgggatgccgagcaacttgaagaaggggtgatccga
ttcaactatacttccgctgacggagaagagggcttccccggtaatctggaagttgaaatg
acttatcgccttgaagaagaagagaatgctattgtcatcgaataccgtgccactacagac
aaagcaacagtcgtaaacctgaccaatcacggtttcttcaacctggcaggaacagccaat
cctactccgactgtagaaaataacatcgtcacaatcaacgcagatttttatactccgatc
gatgaagtatccatcccgacaggagaaatagccaaagtggaaggaactccgatggatttc
cgtaccccacatactgttggcgaacgaatcaatgacaaattccagcaacttatatacggt
gccggctatgaccattgctatgtattgaacaaggcagaaacaggttctctcgacctggca
gctacctgcaaagagcccaacagcggacgcaccatggaggtatataccacagaagccggc
gtacaattatacacaggcaactggctgggcggcttcgaaggaacaaacggagctactttc
cccgcacgaagcgctatctgcttcgaagctcaatgcttccccgacacaccgaataaagca
cacttcccgtcagctactttactgccgggcgatgaataccagcaggtaaccatctataaa
ttcggagttgaaaaataa

DBGET integrated database retrieval system