KEGG   Bacteroides fragilis YCH46: BF1665Help
Entry
BF1665            CDS       T00202                                 

Definition
sulfite synthesis pathway protein CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BF1665
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BF1665
Transfer RNA biogenesis [BR:bfr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BF1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1931364..1932182
Genome map
AA seq 272 aa AA seqDB search
MEHKYLFVAVDAALKAGEEILSIYTDPASDFEIERKADHSPLTIADRKAHVTIATILNET
PFPVLSEEGKHLEYDTRRNWDVMWIVDPLDGTKEFIKRNGEFTVNIALVKAGVPIIGVIY
LPVKKELYFAGQEIGAYKLSGITTLEDDATLDKLVAASVRLPQDLQRDRFVVVASRSHLT
PETEAYIDAVKQEHKHVELISSGSSIKICLVAEGKADVYPRFAPTMEWDTAAGHAIARAA
GMEIYQADKKDVPLQYNKEDLLNPWFIVEKRR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaatacttatttgtcgctgttgatgcagccctgaaggcgggggaggaaata
ttgtctatttataccgatccggcttcggacttcgaaatagagcggaaagcggatcactct
cctttgactattgctgaccggaaagcacacgtaacaattgccaccattctgaacgaaact
ccttttcccgtactgagcgaagaggggaaacatttagagtatgatacccgtcgcaattgg
gatgtgatgtggattgtcgatccattggatggtacgaaagagtttatcaagcgaaacggt
gagtttacggtaaatattgcgttagtgaaagccggagttcccattatcggagtgatttat
ttaccggtcaaaaaagaactttactttgccggtcaggaaatcggtgcctacaagctgtcg
ggcattacgactttagaagacgatgcaacactcgataagctggtagctgcttccgtacgg
ttgccgcaagacctgcagcgggatcgatttgtagtagtggcttcccgttcacacctgact
ccggagaccgaagcgtacattgatgcggtgaagcaagaacacaaacatgtcgagttgatt
tccagcggcagttctattaaaatatgtttggttgccgaaggtaaagcggatgtttatccc
cgttttgctcctacgatggagtgggatactgctgccgggcatgccattgcgcgcgctgcg
ggaatggaaatttatcaggcggataaaaaagatgttcctttgcagtataataaagaagat
ttactgaatccctggtttattgttgagaagagaaggtaa

DBGET integrated database retrieval system