KEGG   Bacteroides fragilis YCH46: BF1751Help
Entry
BF1751            CDS       T00202                                 

Definition
ROK family transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bfr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bfr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfr00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bfr00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:bfr00524]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2058812..2059669
Genome map
AA seq 285 aa AA seqDB search
MKLSIDLGGTNVRIAQVENGICLNKMSVPCLAQQDASAVLDQLFQLITGMMNVQVDGIGI
GVPSIVDVEKGIVYNVANISSWKKIHLKDILEKRFMVPVAINNDSNCFTLGESMFGEGKP
YAHMVGVTIGTGIGAGVIINHRLYCGQYMGAGEIGSLPYLDSDFEHYCSSSFFKRHDTTG
VVVAEKAERGDGAALEIWREFGTHLGNLMKVILFSYAPQAIILGGSIVSAFHFFKDTMKD
AMQDFPYKILLDNVKIITSYLKDASLLGASALFEKQYLPISIINN
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtcaattgatttaggaggaacaaatgttcgaattgcccaagtggagaatggt
atctgtttgaacaagatgtctgtaccttgtcttgcgcaacaagatgcttcagcggtactt
gatcagctttttcaacttattacgggtatgatgaacgtccaggtggatggtattggtatc
ggtgtcccttcaattgtagatgtggaaaaaggtatcgtgtataatgtggcgaatatatct
tcttggaaaaaaatacatttgaaagatatattggaaaagcgatttatggtgccggttgct
attaacaatgactctaattgtttcactttaggcgaaagtatgttcggcgaggggaagcct
tatgcccatatggtgggagttactattgggacaggtataggtgcgggtgttatcattaat
catcggttgtattgtggtcaatatatgggggccggtgaaataggctcgcttccttatctg
gattctgattttgaacattattgcagtagttctttctttaagcgacatgacacgacaggt
gtagtggtagccgaaaaagcagaacggggagatggggctgcgctggaaatctggagggaa
tttgggacgcatctgggtaatttgatgaaagtaattctcttttcttatgctcctcaagct
attattttgggcggaagtatagtatcggcttttcacttttttaaggatactatgaaggac
gctatgcaagatttcccttataaaatactattggacaatgtgaaaataattacttcatat
ttgaaggatgctagcttattaggagcttccgctttgtttgagaaacaatatttaccaata
tctattataaacaattaa

DBGET integrated database retrieval system