KEGG   Bacteroides fragilis YCH46: BF1819Help
Entry
BF1819            CDS       T00202                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00010  Glycolysis / Gluconeogenesis
bfr00030  Pentose phosphate pathway
bfr00051  Fructose and mannose metabolism
bfr00680  Methane metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
bfr01200  Carbon metabolism
Module
bfr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF1819
   00030 Pentose phosphate pathway
    BF1819
   00051 Fructose and mannose metabolism
    BF1819
  Energy metabolism
   00680 Methane metabolism
    BF1819
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BF1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-GeneID: 3084429
NCBI-ProteinID: YP_099100
UniProt: Q64VB2
Position
2142565..2144559
Genome map
AA seq 664 aa AA seqDB search
MTAQSNITPESIVADLRYLQLLSRSFPTIAAASTEIINLEAILNLPKGTEHFLTDIHGEY
EAFQHVLKNASGAVKRKVNEIFGHTLREIEKKELCTLIYYPEEKLQLIKATETDIDDWYL
ITLNQLVKVCQNVSSKYTRSKVRKSLPAEFSYIIQELLHESTIEPNKHAYINVIISTIIS
TRRADDFIIAMCNLIQRLTIDSLHIVGDIYDRGPGAHIIMDTLCDYHNFDIQWGNHDILW
MGAASGNEACMANVIRLSMRYGNLGTLEDGYGINLLPLATFAMDTYADDPCTIFAPKTNF
ADSTYNEKTLRLITQMHKAITIIQFKLEANIINRRPEFGMGGRKLLEKIDFERGVFVYEG
KEYPLRDTNFPTVDPADPYRLTDEEQELIEKIHYSFMNSEKLKKHMRCLFTYGGMYLVCN
SNLLYHASVPLNEDGSFKHVNICGKEYWGKNLLDKIDQLIRTAYFDEDDEEEKRFAMDYI
WYLWCGPDAPSFDKDKMATFERYFIADKSLHKETKGYYYALRNKEEICDRILEEFGVTGQ
HTHIINGHVPVKTIKGEQPMKAGGKLLVIDGGFSKAYQPETGIAGYTLVYHSHGLQLVQH
DPFQSTQKAIEEGQDIKSTTFVIEFNSQRMMVKDTDKGKELVTQILDLKKLLVAYRIGLI
KEKV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcaaagtaatataacccccgaaagtatcgttgccgatctgcgttatctgcaa
ctgctttcacgtagtttccctaccattgccgctgccagtacagagattatcaatcttgaa
gccatcctgaatcttccgaaagggaccgaacattttctgaccgatatacatggcgagtat
gaagcttttcagcatgtattgaaaaatgcttcgggagcggtgaagcggaaagtgaacgaa
atattcggccatactctccgtgagatcgagaagaaagaactctgtacgcttatttattat
ccggaagagaaactccaattgattaaagcaaccgaaaccgatattgacgattggtacctg
atcactctcaatcagctggtaaaggtctgccagaacgtatcatccaaatatacccgttcg
aaggttcgcaaatcattgccggccgagttctcctatatcatccaggagttacttcacgaa
tcgaccatcgagcccaataaacatgcttatatcaatgtgattatcagtaccattatttct
actcgccgcgctgacgactttatcattgccatgtgtaatctgatacagcgtcttacgatc
gattcactccatatcgtgggcgatatctacgatcgtggtccgggtgcccatatcataatg
gatactttgtgtgattatcacaatttcgatatccaatggggaaatcacgatatcctctgg
atgggtgcagcatcgggtaatgaagcttgtatggccaacgtgatccgtctctcgatgcgt
tacggcaatctggggacattggaagatgggtatggcatcaatcttttgcctcttgccact
tttgcgatggatacttatgcggatgatccctgtaccatctttgcacctaagaccaacttt
gccgattctacttataacgagaagaccttgaggctgataacccagatgcataaagctatt
accatcattcagtttaagctggaggcaaacattattaatcgtcgtccggagttcggaatg
gggggtcgcaagttgcttgagaaaatcgactttgaacggggagtatttgtctatgaaggc
aaagaatatccgttgcgcgataccaacttccctacggtagatcctgcagatccttatcgt
ctgactgatgaagagcaggaattgatagaaaagatacattactcgtttatgaacagcgag
aaactcaaaaaacacatgcgttgcctctttacctatggaggtatgtatctggtgtgcaat
tccaatttgctttatcatgcctctgtgcctctcaacgaggatggaagtttcaagcacgtg
aatatctgcggtaaagagtattgggggaagaacttgctggacaagatagaccaattgatt
cgtacggcttattttgatgaagatgatgaagaagagaaacgctttgccatggattacatc
tggtatctgtggtgcggaccggatgccccttcgttcgacaaagacaagatggctacgttc
gaacgttatttcattgcggataagagcctgcataaagagacgaaaggatattattatgct
ttgcgtaacaaagaagaaatctgtgaccggattcttgaagaattcggagtgacagggcag
catactcatatcatcaacggtcatgtgccggtaaagaccattaaaggcgagcagccgatg
aaagccggtggaaaattgctggtcatcgacggtggcttttcgaaagcttatcagccggag
accggtattgccggatatacgctggtatatcattcacatggtttgcagttggtgcagcat
gaccctttccagtctacacagaaagccatcgaagagggacaggacattaagtcgactacc
ttcgtcatcgagttcaattcacaacgaatgatggtgaaagataccgataagggaaaagag
ctcgtaacgcaaattctggatttaaagaagttgttggtagcataccggatcggtttgata
aaggagaaggtctga

DBGET integrated database retrieval system