KEGG   Bacteroides fragilis YCH46: BF1832Help
Entry
BF1832            CDS       T00202                                 

Definition
putative phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:bfr00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2156840..2158222
Genome map
AA seq 460 aa AA seqDB search
MKSMMKPTFRMPRSTSSAIVKNKSFPYMNKKIYVGMTADIMHPGLIHIIHEATKYGDVIV
GLLTDKAIAEHKRLPYLTYDQRKEVVENIKGVCEVVPQEDWSYVPNLEKLKPDYIIHGDD
WKTGPLREVREQVFEVMNAQGGKVIEIPYTRGINSSSLDKDIKAIGTTPDVRLKSLRRLI
QAKPVVRILEAHDGLCGLIIENLEVQKGDKREVFDGMWSSSLTDSTSKGKPDIEAVDLTT
RLQDLNNILECTTKPIIFDGDTGGKIEHFVFTVRTLERHGISAVIIEDKVGLKKNSLFGT
DAIQTQDSIEGFCDKIRAGKNAQVTGDFMIIARIESLIAGKPMSDALERAYAYVQAGADG
IMIHSKDKSGEDIREFCRTFRKEYAHVPIVVVPTTYDHVHESELHEWGANVVIYANHLLR
AAYPAMMNVARTILENERAEEVRPLCMPIKEILELIPGTK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgatgatgaagccgacctttcgtatgccgaggagcacatcatccgctattgtt
aaaaacaaatcttttccatatatgaacaagaaaatctatgtcggtatgaccgcggatatc
atgcatccggggctgatccatattattcatgaagctactaaatacggtgatgtcatcgtc
ggtctgctgacggacaaggccatcgccgaacacaaacgcctcccttaccttacctatgat
cagcgtaaggaggttgttgagaatatcaaaggggtttgcgaagttgttccccaggaggat
tggagctatgttccgaatctggaaaaactcaagcctgactatatcatccacggtgacgac
tggaaaacgggcccgttgcgcgaggtgcgcgaacaggtttttgaggtgatgaacgcccag
gggggcaaggtaatcgagatcccttatacccggggcatcaactcctcctcgctcgacaag
gatatcaaggcgatcgggactacccctgacgtacgtcttaagtccctccgccgcctgatc
caggccaagcctgtggtccgtatcctggaggctcacgacggtctttgcggtctgattatt
gagaatcttgaagtccagaagggtgataagcgcgaggtctttgacggcatgtggtccagc
agcctgaccgactctacgagtaagggtaaaccggatattgaagcggtcgaccttaccacc
cgtttacaggacctgaacaatatccttgaatgtaccaccaagcctattatttttgatgga
gacacgggtggcaagatcgaacactttgtctttactgtgcgcactctggaacgtcacggc
atttctgcggtaatcattgaagataaagtcggtctgaagaagaattccctttttggtact
gacgctatccagactcaggatagtatcgagggtttctgcgataagatcagagcagggaag
aatgcccaggtcaccggtgactttatgatcattgcgcgtatcgaaagccttattgccggc
aaacccatgagtgacgccctcgaacgtgcttatgcctatgtacaggcgggtgcggacggc
atcatgatccacagcaaggataagtcgggtgaggatatccgtgagttctgccggactttc
cgcaaagaatacgcccatgttcccattgtcgttgttccgacgacttatgaccatgtgcac
gaatccgaacttcacgaatggggtgccaacgtagtcatttacgccaaccaccttctccgt
gccgcttacccggccatgatgaacgtggccaggaccatccttgaaaacgagcgcgccgag
gaggtccgtccgctttgtatgcctatcaaggaaattctggaattgattccgggcactaaa
taa

DBGET integrated database retrieval system