KEGG   Bacteroides fragilis YCH46: BF1913Help
Entry
BF1913            CDS       T00202                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BF1913
Enzymes [BR:bfr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BF1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2246744..2248132)
Genome map
AA seq 462 aa AA seqDB search
MNQTVTENHRLRDTIIIGAGLTGLTTAYCLTRKGCDIEVIEQSPCVGGQIRTYHENGFTF
ESGPNTGVISHPEVAELLAELSPTCRLETASEASRQRLIWKGDRFHSLPSGLFSAITTPL
FSTKDKFNILGEPFRAKGNNPDETIGELVQRRLGISYLHYAVDPFISGVYAGDPMRLVTR
HALPKLYQLEQTYGSFILGGIAKSFSHRSERDRLATRKVFSTYGGLSNLTKALEQAIGIK
RFSLGATSTSLMPCEQGWVVSFTDSCGIVNRIHCRKVITTAPAFALPSLLPFVPDKQMNR
ISNLTYAPVMQVSVGLRNTYGKEFHAFGGLVPSCEQKPVLGILFPSACFDNRSPEGGALY
SYFLGGTRHPELLEKSDDEIIRLITTGLNEMLDYPAGIVPDLIRIFRHKKAIPQYESSST
DRFAAINELQKQYPGLVVAGNLKGGIGMADRIKQAVEIARER
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacagtaacagaaaatcatcgtttgcgagataccatcatcatcggtgcaggt
ctaacaggtctgactaccgcctattgccttacccgtaagggatgtgatatcgaggtaatt
gaacagagcccctgcgtaggcggccagatacgtacctaccacgaaaatggttttacgttt
gaaagtgggcccaataccggtgtaatctcccaccctgaagtagccgaactcttggcggaa
ctatcccccacctgccgtttagaaacggccagtgaagcgtccaggcaacgccttatatgg
aaaggagatcgctttcattctctcccctcaggactgttcagtgcaatcaccaccccatta
ttcagtacaaaagataaattcaatatactgggtgaacccttccgtgcaaaaggaaacaat
cccgatgaaacgattggtgaactggtacagcggcgcctgggtatctcttatctacattat
gcagtagacccattcatttccggggtttatgccggtgaccctatgcgattggttacccgt
catgccctgcctaaactttatcaactagaacaaacttatggcagtttcattctcggtggt
attgcaaaatcattttcacatcgaagtgaacgcgaccggttggctacacgaaaagttttc
tctacttatgggggacttagtaacctgacaaaagcattggaacaggccattggaatcaaa
cgattctccctgggagctacttccacttccctaatgccatgtgaacaaggatgggtagtt
tctttcacagattcctgtggaatagttaaccgaatccactgccgaaaggtgataaccacc
gcacctgcctttgccctcccttcacttcttcctttcgtccctgacaaacagatgaatcgg
ataagtaatcttacctatgcccctgtgatgcaagtctccgtgggattgcgtaatacttat
ggaaaagagtttcatgcctttggcggattggttccttcctgtgaacaaaaaccagtttta
ggtattctgtttccatcggcctgtttcgataaccgttcccccgaaggaggtgcattatat
tcatacttcttaggcgggacgagacaccctgaacttctagagaaaagtgacgacgaaatt
atcaggttgataaccaccggcctgaatgaaatgttagattatcctgccggaatagtacct
gatcttatacgtatcttccggcataagaaagccattccccaatacgaaagcagcagtacc
gacagatttgctgcgatcaatgaactgcaaaaacagtatcccggattggtggtagcagga
aatctcaaaggaggaatcggcatggccgaccgcatcaaacaggctgttgaaatcgcccga
gaaagatga

DBGET integrated database retrieval system