KEGG   Bacteroides fragilis YCH46: BF2257Help
Entry
BF2257            CDS       T00202                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00020  Citrate cycle (TCA cycle)
bfr00640  Propanoate metabolism
bfr00660  C5-Branched dibasic acid metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
bfr01200  Carbon metabolism
Module
bfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BF2257
   00640 Propanoate metabolism
    BF2257
   00660 C5-Branched dibasic acid metabolism
    BF2257
Enzymes [BR:bfr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BF2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-GeneID: 3084039
NCBI-ProteinID: YP_099538
UniProt: Q64U25
Position
complement(2627795..2628943)
Genome map
AA seq 382 aa AA seqDB search
MKVHEYQAKEIFSTYGIPVERHALCHTADGAVAAYHRMGVNRVAIKAQVLTGGRGKAGGV
KLANNDRDVYQYAQTILEMTIKGYPVTKILLSEAVNIAAEYYISFTIDRNTRSVTLIMSA
AGGMDIEEVARQSPEKIIRCSIDPLIGVPDYLAHKFAFSLFEQAEQANRMATIIQDLYKA
FIEKDASLAEINPLVLTPVGTLLAIDAKMVFDDNALYRHPDLQKLSEPTEDEKLEAIAKE
RGFSYVRMDGEIGCMVNGAGLAMTTMDMIKLYGGNPANFLDIGGSSNPVKVIEAMRLLLD
DKKVKVVFINIFGGITRCDDVAIGLLQAFEQIQTDIPIIVRLTGTNGNMGRELLRKNNRF
QVAQTMEEATKMAIESLKKESI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacacgaatatcaggcaaaggagattttctccacttacggaatacctgtcgag
aggcatgctttatgccatacggcagatggggctgtggctgcttatcaccgaatgggggta
aaccgggtagccataaaagcccaagtgctgaccggcgggcggggaaaagccggcggagta
aagttggccaataatgatagagatgtctaccaatacgctcaaactattttggagatgact
ataaaaggttatcccgtcaccaagattcttcttagtgaggctgtcaacattgcagccgaa
tattacatcagttttacgatagaccgtaatacgcgctctgtcacgctgattatgagtgcg
gccggtggtatggacatcgaggaagtagcccgccaatctccggaaaagataatacgttgc
agcattgatcctctaatcggagttcccgattatctggcacataagtttgctttctctctc
tttgaacaagctgagcaagctaaccggatggcaactattattcaagatctttacaaagca
tttattgaaaaagatgcttcacttgctgaaattaatccattggtacttacccctgttggg
acattattggctattgatgccaaaatggtttttgatgataatgcactttatcgtcatccg
gacttacagaagttatcagagcccacagaagatgagaagttggaagcgattgccaaagaa
agaggattcagctatgtgcgcatggacggcgagataggctgtatggttaatggagccggt
ctggctatgacaactatggatatgatcaagctttatggaggaaatccggctaatttcctt
gatattggcggtagttcaaatcctgtcaaggtgatagaagctatgagattattgctggat
gacaaaaaagtcaaagtagtctttatcaatattttcggaggtatcacccgatgtgacgat
gtagccatcggactcttacaggcgtttgagcagatacaaacggatattcctattattgtg
cggcttacaggcactaatggaaatatgggacgtgaattattgcgtaagaataaccgtttt
caagtggcccaaacaatggaagaagctactaaaatggctatagaatcattaaagaaagaa
tcgatatga

DBGET integrated database retrieval system