KEGG   Bacteroides fragilis YCH46: BF2257Help
Entry
BF2257            CDS       T00202                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF2257
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BF2257
   00640 Propanoate metabolism
    BF2257
   00660 C5-Branched dibasic acid metabolism
    BF2257
Enzymes [BR:bfr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BF2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2627795..2628943)
Genome map
AA seq 382 aa AA seqDB search
MKVHEYQAKEIFSTYGIPVERHALCHTADGAVAAYHRMGVNRVAIKAQVLTGGRGKAGGV
KLANNDRDVYQYAQTILEMTIKGYPVTKILLSEAVNIAAEYYISFTIDRNTRSVTLIMSA
AGGMDIEEVARQSPEKIIRCSIDPLIGVPDYLAHKFAFSLFEQAEQANRMATIIQDLYKA
FIEKDASLAEINPLVLTPVGTLLAIDAKMVFDDNALYRHPDLQKLSEPTEDEKLEAIAKE
RGFSYVRMDGEIGCMVNGAGLAMTTMDMIKLYGGNPANFLDIGGSSNPVKVIEAMRLLLD
DKKVKVVFINIFGGITRCDDVAIGLLQAFEQIQTDIPIIVRLTGTNGNMGRELLRKNNRF
QVAQTMEEATKMAIESLKKESI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacacgaatatcaggcaaaggagattttctccacttacggaatacctgtcgag
aggcatgctttatgccatacggcagatggggctgtggctgcttatcaccgaatgggggta
aaccgggtagccataaaagcccaagtgctgaccggcgggcggggaaaagccggcggagta
aagttggccaataatgatagagatgtctaccaatacgctcaaactattttggagatgact
ataaaaggttatcccgtcaccaagattcttcttagtgaggctgtcaacattgcagccgaa
tattacatcagttttacgatagaccgtaatacgcgctctgtcacgctgattatgagtgcg
gccggtggtatggacatcgaggaagtagcccgccaatctccggaaaagataatacgttgc
agcattgatcctctaatcggagttcccgattatctggcacataagtttgctttctctctc
tttgaacaagctgagcaagctaaccggatggcaactattattcaagatctttacaaagca
tttattgaaaaagatgcttcacttgctgaaattaatccattggtacttacccctgttggg
acattattggctattgatgccaaaatggtttttgatgataatgcactttatcgtcatccg
gacttacagaagttatcagagcccacagaagatgagaagttggaagcgattgccaaagaa
agaggattcagctatgtgcgcatggacggcgagataggctgtatggttaatggagccggt
ctggctatgacaactatggatatgatcaagctttatggaggaaatccggctaatttcctt
gatattggcggtagttcaaatcctgtcaaggtgatagaagctatgagattattgctggat
gacaaaaaagtcaaagtagtctttatcaatattttcggaggtatcacccgatgtgacgat
gtagccatcggactcttacaggcgtttgagcagatacaaacggatattcctattattgtg
cggcttacaggcactaatggaaatatgggacgtgaattattgcgtaagaataaccgtttt
caagtggcccaaacaatggaagaagctactaaaatggctatagaatcattaaagaaagaa
tcgatatga

DBGET integrated database retrieval system