KEGG   Bacteroides fragilis YCH46: BF2268Help
Entry
BF2268            CDS       T00202                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bfr  Bacteroides fragilis YCH46
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2641212..2642603)
Genome map
AA seq 463 aa AA seqDB search
MKKSTKFIIALLVTVGALAITYRVVNQAPSKDLAADAQMQEIITSGGCLQCHSGSPDLPF
YANWPVASGMVQKDVTQGYRAFDMTEMAEALKAGKPVGKVALAKVEKVIMDGTMPKHAYY
MVHWGSSVTDAKKEMAMAWVKQHRLAHYANGLAAAEFANEPIRPIADSIPVDMRKVILGD
MLYHDTRLSADNTVSCASCHGLNTGGVDNKQYSEGVGGQFGGVNAPTVYNAAYNFVQFWD
GRAGTLAEQAAGPPLNPVEMACQSFDEIIAKLEQDANFTKAFLAVYPDGYSEQNITNAIE
EFEKTLLTPNSRFDLYLKGEKTAINDIELAGYELFKKYDCATCHVGETLGGQSYELMGVK
RDYFADRGIELTEEDNGRFKQTRNERDKHRFKVPGLRNIALTAPYFHDGSMKTMKEAVDY
MAKYQMDLNLPEDELNKIVAFLETLTGEYKGKPLTNDNQTKAL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtacaaaatttatcatcgcattgcttgtgacagtcggggcactggctatc
acttaccgcgttgtaaaccaagcaccgtcgaaagatcttgctgctgatgctcagatgcag
gaaatcattacttcggggggatgtttacaatgtcattcgggcagtccggaccttcctttc
tatgccaactggcccgttgcaagcggaatggtacagaaagacgtaacgcaaggttatcgt
gctttcgacatgaccgaaatggctgaagctctgaaagccggtaagcctgtcggaaaagta
gcacttgctaaagtcgaaaaagtaatcatggacggaacgatgcccaaacatgcttattac
atggtacattggggatcgagcgtaacagatgccaagaaggaaatggctatggcatgggtt
aaacaacatcgcttggcacattatgctaacggactggctgccgccgagtttgccaatgaa
ccgatacgtcccatcgcagattctattcctgtggatatgcgtaaagtcatcttgggagat
atgctctatcatgacactcgcctttcggccgataacaccgtttcatgtgcttcgtgtcac
ggattgaataccggtggtgtggacaataagcaatattcggaaggtgtaggcggacagttc
ggaggcgtaaatgctccgacagtgtataacgccgcttacaatttcgtccagttctgggat
ggacgtgccggaacacttgccgagcaggctgccggacctcctttgaatccggtcgagatg
gcctgtcagtcatttgatgaaatcattgcgaaactggagcaggatgcaaactttaccaaa
gcctttttggctgtatatcccgatggttattccgaacagaatatcacgaatgcgatcgag
gagtttgaaaagacactgcttactccgaattcccgtttcgacctttatctgaaaggtgaa
aagactgccattaacgatatagagctggccggatacgaattgtttaagaaatacgattgt
gctacatgtcatgtcggtgagacactgggcggccagtcttacgaactgatgggcgtaaag
agagactacttcgcagatcgcggcattgaattgacagaagaagataacggacgtttcaaa
caaacccggaacgaacgtgacaaacatcgctttaaagtgcccggtttgagaaacattgcc
ctgacggctccttacttccatgacggcagtatgaaaacaatgaaagaggctgtagattac
atggccaaatatcagatggatctgaatcttccggaagatgaactgaataaaatcgttgct
tttctggagacactgaccggggagtacaaaggtaagcccctgaccaacgataatcagacc
aaagcattataa

DBGET integrated database retrieval system