KEGG   Bacteroides fragilis YCH46: BF2296Help
Entry
BF2296            CDS       T00202                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BF2296
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BF2296
Enzymes [BR:bfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BF2296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2669594..2670142
Genome map
AA seq 182 aa AA seqDB search
MNYIQTEIDGVWIIEPKIFFDPRGYFMEAFKQQEFDATIGQINFIQDNESQSSFGTLRGL
HYQKGAYSQAKLVRVIKGEVLDVAVDLRKSSPTFGKHISVLLSDENKRQLFIPRGFAHGF
LVKSEIAIFTYKVDNIYAPQSEASILYNDPALAIDWPIADSQLVMSEKDKQAGAFREAEY
FE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatacaaacagaaatagatggtgtgtggatcattgaaccgaagatttttttc
gatccgcgcggatatttcatggaagcattcaagcaacaggaatttgatgctactatcgga
cagataaattttatacaagataatgaatctcaatcttcattcggcacgttacgcggactc
cattatcaaaaaggagcctatagccaagccaaactagtgcgtgtcatcaaaggtgaagtg
ctggatgtggctgtcgatttaagaaagtcatcacctacatttggaaagcatatcagcgta
ttgttaagcgacgaaaataaacgccagctttttattccccgtgggtttgcccatggattt
ttagtgaaaagcgaaatagctatctttacttataaggtagataatatatatgccccccaa
tctgaggcttctatcctatacaatgatccggcattggctatcgactggcctattgccgat
tctcaacttgtcatgtcagagaaagacaagcaggcaggagcctttcgggaagcagaatat
tttgaatag

DBGET integrated database retrieval system