KEGG   Bacteroides fragilis YCH46: BF2650Help
Entry
BF2650            CDS       T00202                                 

Definition
(RefSeq) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BF2650
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF2650
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BF2650
Enzymes [BR:bfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BF2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3050565..3051737
Genome map
AA seq 390 aa AA seqDB search
MKSFLVDQDGYYGEFGGAYVPEILHKCVEELQNTYLDVIESEDFKKEFDQLLRDYVGRPS
PLYPARRLSEKYGCKMYLKREDLNHTGAHKINNTIGQILLARRMGKKRIIAETGAGQHGV
ATATVCALMNMECIVYMGKTDVERQHINVEKMKMLGATVVPVTSGNMTLKDATNEAIRDW
CCHPSDTYYIIGSTVGPHPYPDMVARLQSVISEEIKKQLQEKEGRDYPDYLIACVGGGSN
AAGTIYHYIDDERVRIVLAEAGGKGIETGMTAATIQLGKMGIIHGARTFVIQNEDGQIEE
PYSISAGLDYPGIGPMHANLADKKRAMVLAVNDDEAIRAAYELTRLEGIIPALESAHALG
ALEKITFKPEDVVVLTVSGRGDKDIETYLG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttttttagttgatcaggatggctattacggagaatttggaggtgcttatgta
cctgaaatcctccacaagtgtgtagaagagttgcagaatacttatctcgacgtaatagag
agcgaggacttcaagaaagagttcgaccaattgttgcgtgactacgtaggacgcccttcc
ccgctctatccggcccgccgcctgtcggagaagtacggttgcaagatgtatctgaaacgg
gaagacctgaatcacacgggtgcccataaaatcaataacaccatcggacaaattctactg
gcaagacgcatgggtaagaaacgtatcattgcggagaccggtgccggacagcacggggtg
gcaacagccacagtctgtgccctgatgaacatggagtgcatcgtatacatgggcaaaacg
gatgtagaacgccagcacatcaatgtagaaaagatgaaaatgctgggagcgacagtcgtt
ccggtcacttcgggcaacatgactctgaaagatgccacgaacgaagccatccgagactgg
tgctgccatccctcggatacgtattacatcatcggttctaccgtagggccgcacccatat
ccggacatggtggcccgtttgcagtcggtcatcagcgaagagataaaaaaacagcttcag
gagaaagaaggacgtgactatccggactatctgattgcctgcgtgggcggaggaagcaac
gctgccggaaccatctatcattacatcgacgacgaacgggtacggatcgtattggccgaa
gccggcggcaagggaattgaaaccgggatgacggcagccaccatccaactcggaaaaatg
gggatcattcatggggcacgtacgtttgtgatccaaaacgaagacggacagattgaggaa
ccttattccatctccgccggactggactatcccggtatcggcccgatgcacgccaacctg
gcagacaaaaaacgggcaatggtactggctgtcaatgatgacgaagccatccgtgccgct
tacgagttgacccggctggaaggaatcattcctgccctggaatcggcccacgcattggga
gccttggaaaaaataactttcaagccggaggatgtagtcgtactgacggtatcgggacgg
ggagataaagatatagaaacttatctgggataa

DBGET integrated database retrieval system