KEGG   Bacteroides fragilis YCH46: BF2654Help
Entry
BF2654            CDS       T00202                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BF2654
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BF2654
Enzymes [BR:bfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BF2654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3055085..3055897
Genome map
AA seq 270 aa AA seqDB search
MKDILSEIIANKRFEIDLQKQAIPSEQLQEKLSDEVQPGYSMKQALASSATGIIAEFKRR
SPSKGWIYENACPEQVVPDYIAAGASALSILTDEKFFGGSLKDIRTARPLVNIPILRKDF
IIDEYQLFQAKIVGADAILLIAAALEADQCHALAAKAHELGLEVLLEIHTAEELPFINKE
IDMIGINNRNLGTFFTDVENSFRLAGQLPQDALLVSESGISDPKTVKRLRKAGFRGFLIG
ETFMKAQQPGQKLKEFINDLNSPQSDTESH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatattatctgaaatcattgccaataaacgttttgagatcgacctgcagaaa
caggccatcccatcggaacagcttcaggagaagttatctgacgaggtacagccgggctac
tccatgaagcaggcactggcctcttcggctaccggtatcattgccgagttcaaacgccgg
tctccgtccaaaggttggatctatgaaaatgcatgtccggaacaagtcgtgccggactat
atagccgccggtgcttcggcgctttctatactcacggatgaaaaattcttcggaggaagc
ctgaaggatattcgcacagcacgccctttggtgaatatcccgatcctgcgcaaagatttt
ataatcgatgaatatcaactgttccaggccaaaattgtgggagccgacgccatactgcta
atagccgccgcactggaggccgatcaatgtcatgcgcttgccgcaaaagcccatgaattg
ggactggaagtcttgctagaaattcatactgccgaagaactgccatttataaataaggag
atagacatgataggtatcaataaccgcaacctgggcactttcttcacagatgtagagaat
tctttccggttagccggacagttgcctcaggatgcgctgttggtatcggaaagcggcatc
tcagatccgaaaacagtgaaacgcctgcgtaaagccgggttccggggattcctgatcgga
gaaacgtttatgaaagcccaacagcccggacagaaattaaaagaatttataaacgacctg
aattcaccacagagtgacacagagtctcactga

DBGET integrated database retrieval system