KEGG   Bacteroides fragilis YCH46: BF2656Help
Entry
BF2656            CDS       T00202                                 

Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BF2656
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF2656
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BF2656
Enzymes [BR:bfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BF2656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3056668..3057459
Genome map
AA seq 263 aa AA seqDB search
MNRINQLFDSNPRDLLSIYFCAGYPTLEGTTEVIRTLEKHGVNMIEIGIPFSDPMADGMV
IQNAATQALRNGMSLRLLFEQLHDIRRDVKIPLILMGYLNPIMQFGFDNFCRQCAECGID
GVIIPDLPFKDYQEHFRTIAERYDVKVIMLITPETSEERVREIDEHTDGFIYMVSSAATT
GAQQDFDGQKRAYFKKIEKMNLRNPRMVGFGISNEATFRAACENASGAIIGSRFVTLLHE
EKNPEKAITRLKAILNLSSNDLR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaataaaccaacttttcgacagcaatcccagggatttgctatccatctatttt
tgtgccggctatcctactctcgaagggacaaccgaagtaatccgtactcttgaaaaacat
ggagtgaacatgattgaaatcggtattcctttcagcgatccgatggctgacggtatggtg
attcagaatgccgccacgcaggccctccgcaacggaatgtcactcagactattgtttgaa
caactgcacgacatccgtcgggatgtaaaaatcccattaatcctgatgggatatctcaac
ccgatcatgcagttcggctttgacaacttctgccggcaatgcgccgaatgcggcattgac
ggagtcatcattcccgaccttcctttcaaggactatcaggaacacttccgcaccattgca
gagcggtatgacgtgaaggtaatcatgcttatcacccctgaaacaagtgaagaacgcgta
cgcgagattgatgaacacaccgacggattcatttatatggtttcatcggctgccaccaca
ggagctcaacaagactttgacgggcaaaaacgtgcttactttaaaaagatcgaaaaaatg
aatcttcgcaatccccggatggtcggtttcggtatcagcaacgaggctaccttccgtgcc
gcttgcgaaaatgcctcgggagccatcatcggcagccgttttgtcactctgctccatgaa
gagaagaacccggagaaagcaatcacacgcttaaaagctattttgaatttatcatccaat
gatttgagataa

DBGET integrated database retrieval system