KEGG   Bacteroides fragilis YCH46: BF3249Help
Entry
BF3249            CDS       T00202                                 

Definition
(RefSeq) beta-hexosaminidase precursor
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00511  Other glycan degradation
bfr00520  Amino sugar and nucleotide sugar metabolism
bfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BF3249
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BF3249
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BF3249
Chaperones and folding catalysts [BR:bfr03110]
 Intramolecular chaperones
  Others
   BF3249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glyco_hydro_67N
Motif
Other DBs
NCBI-GeneID: 3082048
NCBI-ProteinID: YP_100527
UniProt: Q64R88
Position
complement(3689067..3690716)
Genome map
AA seq 549 aa AA seqDB search
MNKKLLSRLAPGLFAVVLFTACRPAATVKGNLDVIPQPQEIVLARDTTPFIIDRSTTIVY
PATNEKMHRTADFLATFIKEMTGTEVRVSDKEKSSNAIILAVDSTMGHPEGYKLQITPEK
VLLTGGSEAGVFYGIQTIHKALPILKDGKVAAALPAGTVTDFPRFRYRGFMIDVGRHFFP
VSYLKQMIDLMALHNINYFHWHLTEDQGWRIEIKKYPKLTEIGSKRDSTIIDWETKKFDG
KPHSGFYTQDEAREIVRYAADRFITVVPEIDLPGHTTAALASYPELGCTGGPYKVLCSFG
VFPDVLCAGNDQTLQFTKDVLDEIMDIFPSEYIHIGGDECPKSRWEKCPKCQAKIKELGI
KTLPKHSKENQLQTYFMSELEKEINAHGRRMLGWDEVLEGGLTPNSTIMSWRGIQGGIEA
ARQHHDVIMTPIQRLYFSNPRINKMTGFEWMNRVYNFEPVPAELTDAEKKFVIGTQGCIW
TEWTADSTKMEWQILPRMAALSEIQWTLPEHKNFERFMERLPEMLKIYSSLDYGYREDVF
AADTLKTHK
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaactactatcccgtttagctcccggtttgtttgccgttgtgctattcaca
gcctgccgcccggcagccaccgtaaagggtaatttggacgtaatccctcaaccgcaggag
attgtccttgcccgggacactactccttttattattgaccgcagcactacgattgtctac
ccggcaaccaatgaaaagatgcatcgtactgctgattttctggctacttttattaaagaa
atgaccggaaccgaggttcgtgtatcggacaaagagaaaagcagcaatgctattattctt
gctgtagactccacaatggggcatccggaaggttataaacttcaaatcactcctgaaaag
gttcttttgacgggaggcagtgaagccggtgtcttttatggtatccagactattcataaa
gctcttccgatcctgaaagacggtaaggtggcagctgcccttcctgccggtacggttacc
gactttccccgtttccgttaccggggattcatgatcgatgtaggccgtcacttcttcccg
gtcagctaccttaagcagatgattgacctgatggcactgcataacatcaactactttcat
tggcacctgaccgaagatcagggatggcgaatcgaaatcaagaaatatcccaaactgaca
gagatcggttctaaacgagactctaccattatcgattgggaaaccaagaaattcgacggg
aagccccatagtggattttatacacaggacgaagctcgtgagattgttcgctatgctgcc
gaccgtttcattacggtagttcccgaaattgaccttccgggacatactactgctgcactg
gcttcttatccggaactgggatgtacaggtggtccgtacaaagtactttgctcattcggt
gtcttccccgatgtactctgtgcaggtaatgaccagacacttcagttcaccaaagatgta
ttggatgaaattatggatatcttcccttccgaatatattcatatcggcggtgacgaatgt
ccgaaaagccgttgggagaagtgtcccaaatgtcaggctaaaattaaggagttgggtatc
aaaaccctgcctaaacattcgaaagagaatcagttgcaaacctacttcatgtccgagctg
gagaaagaaatcaatgctcacggacgccgtatgctgggatgggatgaggtattggaagga
ggtctgactccgaactccactatcatgtcatggagaggaattcagggaggaatcgaagct
gcccgccagcatcatgatgtcattatgactcctattcagcggctctatttcagtaatccg
cgtatcaataaaatgacgggattcgaatggatgaaccgtgtatacaactttgaaccggta
cctgcagaactgaccgatgcggaaaagaagtttgtgattggtactcaaggatgtatctgg
accgaatggacagccgattcaacgaagatggagtggcagattctgccccgaatggctgct
ttgtccgaaatacaatggacattgccggagcataagaactttgagcgtttcatggagcgc
ctacccgagatgctgaagatttattcttctctggattatggttatcgggaagatgtattc
gcggcggataccttgaagactcataaataa

DBGET integrated database retrieval system