KEGG   Bacteroides fragilis YCH46: BF3252Help
Entry
BF3252            CDS       T00202                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF3252
   01230 Biosynthesis of amino acids
    BF3252
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF3252
  Energy metabolism
   00680 Methane metabolism
    BF3252
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF3252
Enzymes [BR:bfr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BF3252
Exosome [BR:bfr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BF3252
  Exosomal proteins of melanoma cells
   BF3252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3695104..3695850)
Genome map
AA seq 248 aa AA seqDB search
MKKIVLLRHGESAWNKENRFTGWTDVDLTEKGIAEACKAGELLKENGFNFDKAYTSYLKR
AVKTLNCVLDRMDQDWIPVEKSWRLNEKHYGDLQGLNKSETAAKYGDEQVLIWRRSYDIA
PNALSEDDPRNPRFENRYQEVPDAELPRTESLKDTIERIMPYWKCIIFPNLKTADEILVV
AHGNSLRGIIKHLKHISDEEIVKLNLPTAVPYVFEFSDELNLEKDYFLGDPEEIRKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgtattgctccgtcatggagaaagtgcatggaacaaagagaaccgtttt
accggttggacagatgtcgatctgacagaaaaaggaattgccgaagcctgtaaagcaggc
gaactactgaaagagaatggatttaacttcgataaagcttatacgtcataccttaaacga
gcggtgaaaacgctgaattgcgtactcgaccggatggatcaggactggattccggtagag
aaaagctggcgcctgaatgaaaaacattacggcgatctgcaaggactgaacaaaagcgaa
acagccgctaaatacggggatgaacaggtgcttatctggcgcaggagttatgatatagct
cccaatgccctgtcggaagacgatccgagaaatccccgctttgagaatcgttatcaggaa
gtacccgatgcggaacttcctcggacagaatctctgaaagatactatcgaacgtatcatg
ccttattggaagtgtatcatcttcccgaatctgaaaacggctgatgaaattctggttgtt
gcccacggaaatagtttgcgcggcatcatcaagcacttgaagcacatctccgatgaagag
atcgtaaaactgaatctgccgactgccgtcccttacgtatttgagttcagtgacgaactg
aatctggaaaaagactatttcctgggtgatcccgaagaaatccgtaagttgatggaagcg
gttgccaaccagggaaagaaaaaataa

DBGET integrated database retrieval system