KEGG   Bacteroides fragilis YCH46: BF3689Help
Entry
BF3689            CDS       T00202                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bfr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4196791..4197396)
Genome map
AA seq 201 aa AA seqDB search
MIEYIKGEIAELSPATAVIDCNGLGYAVNISLNTYSAIQGKSSCKLYIYEAIREDAYVLY
GFADKQERELFLLLISVSGIGGNTARMILSALSPAELVNVISTENANMLKTVKGIGLKTA
QRVIVDLKDKIKTGAMAATAVGGAAGALLPAMNAEVQEEAIAALTMLGFAAAPSQKAVLA
ILKEEPDAPVEKVIKLALKRL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatagaatacatcaaaggcgaaattgccgaactgagtccggcaaccgcagttatcgat
tgtaacggattaggatatgccgttaatatatcactcaacacttattctgccattcagggt
aagagcagttgtaaactctatatctacgaagccatccgcgaagatgcttacgttttatat
ggctttgccgacaagcaggaacgggaacttttcctgctgctgatttccgtttcgggtatt
ggaggaaacacggcccgtatgattctttctgctctttcaccggccgaactggtgaatgtg
atcagtaccgaaaatgccaatatgctgaagacggtgaaaggtatcggactgaagaccgca
cagcgtgtcattgtcgatttgaaagataaaattaaaaccggtgccatggctgcaactgcc
gtgggaggtgctgccggtgctttgttgccggcaatgaatgcggaagtacaggaagaggcc
atcgctgcattgaccatgctcggatttgccgctgcaccttcacagaaggcggtgcttgcc
atattgaaagaagaacccgatgctccggtggagaaagtcattaagctggctttaaaaaga
ctttga

DBGET integrated database retrieval system