KEGG   Bacteroides fragilis YCH46: BF3689Help
Entry
BF3689            CDS       T00202                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BF3689
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BF3689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4196791..4197396)
Genome map
AA seq 201 aa AA seqDB search
MIEYIKGEIAELSPATAVIDCNGLGYAVNISLNTYSAIQGKSSCKLYIYEAIREDAYVLY
GFADKQERELFLLLISVSGIGGNTARMILSALSPAELVNVISTENANMLKTVKGIGLKTA
QRVIVDLKDKIKTGAMAATAVGGAAGALLPAMNAEVQEEAIAALTMLGFAAAPSQKAVLA
ILKEEPDAPVEKVIKLALKRL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatagaatacatcaaaggcgaaattgccgaactgagtccggcaaccgcagttatcgat
tgtaacggattaggatatgccgttaatatatcactcaacacttattctgccattcagggt
aagagcagttgtaaactctatatctacgaagccatccgcgaagatgcttacgttttatat
ggctttgccgacaagcaggaacgggaacttttcctgctgctgatttccgtttcgggtatt
ggaggaaacacggcccgtatgattctttctgctctttcaccggccgaactggtgaatgtg
atcagtaccgaaaatgccaatatgctgaagacggtgaaaggtatcggactgaagaccgca
cagcgtgtcattgtcgatttgaaagataaaattaaaaccggtgccatggctgcaactgcc
gtgggaggtgctgccggtgctttgttgccggcaatgaatgcggaagtacaggaagaggcc
atcgctgcattgaccatgctcggatttgccgctgcaccttcacagaaggcggtgcttgcc
atattgaaagaagaacccgatgctccggtggagaaagtcattaagctggctttaaaaaga
ctttga

DBGET integrated database retrieval system