KEGG   Bacteroides fragilis YCH46: BF3689Help
Entry
BF3689            CDS       T00202                                 

Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BF3689
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BF3689
DNA repair and recombination proteins [BR:bfr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BF3689
    RecFOR pathway proteins
     BF3689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(4196791..4197396)
Genome map
AA seq 201 aa AA seqDB search
MIEYIKGEIAELSPATAVIDCNGLGYAVNISLNTYSAIQGKSSCKLYIYEAIREDAYVLY
GFADKQERELFLLLISVSGIGGNTARMILSALSPAELVNVISTENANMLKTVKGIGLKTA
QRVIVDLKDKIKTGAMAATAVGGAAGALLPAMNAEVQEEAIAALTMLGFAAAPSQKAVLA
ILKEEPDAPVEKVIKLALKRL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatagaatacatcaaaggcgaaattgccgaactgagtccggcaaccgcagttatcgat
tgtaacggattaggatatgccgttaatatatcactcaacacttattctgccattcagggt
aagagcagttgtaaactctatatctacgaagccatccgcgaagatgcttacgttttatat
ggctttgccgacaagcaggaacgggaacttttcctgctgctgatttccgtttcgggtatt
ggaggaaacacggcccgtatgattctttctgctctttcaccggccgaactggtgaatgtg
atcagtaccgaaaatgccaatatgctgaagacggtgaaaggtatcggactgaagaccgca
cagcgtgtcattgtcgatttgaaagataaaattaaaaccggtgccatggctgcaactgcc
gtgggaggtgctgccggtgctttgttgccggcaatgaatgcggaagtacaggaagaggcc
atcgctgcattgaccatgctcggatttgccgctgcaccttcacagaaggcggtgcttgcc
atattgaaagaagaacccgatgctccggtggagaaagtcattaagctggctttaaaaaga
ctttga

DBGET integrated database retrieval system