KEGG   Bacteroides fragilis YCH46: BF3699Help
Entry
BF3699            CDS       T00202                                 

Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00900  Terpenoid backbone biosynthesis
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BF3699
Enzymes [BR:bfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BF3699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 3084781
NCBI-ProteinID: YP_100976
UniProt: Q64PY9
Position
complement(4208713..4209879)
Genome map
AA seq 388 aa AA seqDB search
MNEIKKKQIAILGSTGSIGTQALQVIEEHPELYEVYALTANNKVDLLIAQARKFMPEAVV
IANEEKYAQLKEALSDLPVKVYAGAAALCQIVESGPIDVVLTAMVGYAGLKPTMNAIRAG
KAIALANKETLVVAGELINQLARQYRTPILPVDSEHSAVFQCLAGEVGNPIEKVILTASG
GPFRTCTMEQLKTVTKVQALKHPNWEMGAKITIDSASMMNKGFEVIEAKWLFGVQPGQIE
VVVHPQSVIHSMVQFEDGAIKAQLGMPDMRLPIQYAFSYPDRINSSFDRLDFSKCTNLTF
EQPDTKRFRNLALAYESMYRGGNMPCIVNAANEVVVAAFLRDEISFLGMSDVIEHTMGQV
SFVQTPTYDDYVATDAEARRIARELICK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagataaagaagaaacaaatagctatcttaggttctacgggttctattggtacc
caggccttgcaggttatcgaagagcatcccgaactgtacgaggtgtatgcactgactgcc
aataataaggtagatctcctgatagcccaggcacgtaagtttatgcctgaggctgtagtt
atagccaatgaagagaaatatgcccaactgaaagaggctctcagcgacctgcctgttaag
gtgtatgcaggtgctgccgcgttatgccagattgtagagtccggccctatcgatgtagtc
ctgaccgctatggtggggtatgcgggattgaagccgaccatgaatgccattcgtgccgga
aaagccattgcccttgccaataaagagacactggtagttgccggagagttgattaatcag
ttagcccggcaataccgtacaccgattcttcctgtcgattccgaacattcggcagtattc
cagtgtttggccggagaggtaggcaatccgatagagaaagttatcctgactgcttccgga
ggtcctttccgtacatgtactatggaacagttgaagactgtgacaaaagtacaggctctc
aaacatccgaattgggaaatgggagctaagatcactattgattctgcctcgatgatgaac
aaggggttcgaagtgatcgaagccaaatggttgtttggcgtacagcccggccagattgag
gtggtggtacatccgcagtcggttattcattcgatggtgcagtttgaggatggagcaata
aaggcccagttgggaatgcccgatatgcgtctgcccattcagtatgctttctcttatccc
gatcgcatcaattcgtctttcgaccggcttgatttttcgaaatgtacgaaccttactttt
gagcaacccgataccaagcggttccgtaatctggcattggcctatgaatcgatgtatagg
ggagggaatatgccttgcatcgtaaatgcggccaacgaggtggttgtggcggcttttctt
cgtgatgaaatcagctttctcggcatgagtgatgtgatagaacataccatggggcaggtg
tctttcgtacagactcctacttacgacgactatgtggcaaccgatgcggaagcacgccgg
attgcccgtgaattaatatgtaaataa

DBGET integrated database retrieval system