KEGG   Bacteroides fragilis YCH46: BF3707Help
Entry
BF3707            CDS       T00202                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BF3707
Enzymes [BR:bfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BF3707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4215972..4216586
Genome map
AA seq 204 aa AA seqDB search
MNPTERITTPHKTGEAKVIIFSAPSGSGKSTIINYLLAQKLNLAFSISATSRPPRGNEKH
GVEYFFLSPDEFRQRIANNEFLEYEEVYTDRFYGTLKAQVEKQLAAGQNVVFDVDVVGGC
NIKKYYGERALSLFIQPPCIDELRRRLIGRGTDTPEVIESRIAKAEYELSFAPKFDKVII
NDDLETAKAHALKVIKEFLGIDTE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaactgaaagaataactaccccacacaaaacgggtgaagccaaagtaatcatc
ttttctgctccttccggatcgggtaagtcaacaatcataaattatttgttggctcaaaag
ttgaatcttgcattctcgatctcagccaccagtcgtcccccccggggaaacgaaaagcat
ggagtagaatattttttcctctctcccgatgaattccgtcaacgcattgcaaacaatgaa
ttcctggaatacgaggaagtatataccgaccggttctacggcactctgaaagcacaggta
gaaaaacagcttgctgccggacaaaatgttgtgttcgatgtagatgtcgtaggtggctgt
aacatcaagaaatattatggtgaacgggcactttcgctttttatccagcctccctgcatt
gacgaactgcgccgccgtctgatcggacgcggaacagatactcccgaagtgatcgagagt
cggatagccaaagccgaatatgaattaagctttgctccgaaatttgataaggttatcatt
aatgacgacctggaaacagccaaggcacacgcattgaaagtgatcaaagagtttctgggc
atcgatacagaataa

DBGET integrated database retrieval system