KEGG   Bacteroides fragilis YCH46: BF3749Help
Entry
BF3749            CDS       T00202                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bfr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bfr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bfr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfr00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bfr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4254522..4255511
Genome map
AA seq 329 aa AA seqDB search
MIVMGTVKCVGILTSGGDAPGMNAAIRAVTRAAIYNGLQVKGIYRGYRGLVTGEIKEFKS
QNVSNIIQLGGTILKTARCKEFTTPEGRKMAYDNMVKEGIDALVVIGGDGSLTGARIFAQ
EYDIPCIGLPGTIDNDLYGTDTTIGYDTALNTILDAVDKIRDTATSHERLFFVEVMGRDA
GFLALNGAIASGAEAAIIPEFSTEVDQLEEFIKSGFRKSKNSSIVLVAESELTGGAMHYA
ERVKNEYPQYDVRVTILGHLQRGGSPTAHDRILASRLGAAAIDAIMEDQRNVMIGIEHDE
IVYVPFSKAIKNDKPVKRDLVNVLRELSI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattgttatgggaacagttaagtgtgttggtattttaacttccggtggtgatgcaccg
ggaatgaacgctgctattcgtgcagtaacgcgtgcagcaatctacaacggactgcaagta
aaaggtatatatagaggatacagaggcttggtgacaggagagatcaaggagtttaagagc
cagaatgtaagtaacatcattcaactgggaggaacgatcctgaagacagcacgttgcaaa
gagtttacaactcccgaaggacgtaaaatggcatacgacaatatggtgaaagaaggaatc
gatgcccttgtagtgatcggtggcgacggttcgctgaccggagcacgcatctttgcacaa
gagtatgacattccatgcatcggacttccgggaaccatcgacaatgacctttacggcacc
gacacgaccatcggatacgatacggcgctgaacactattttggatgctgtcgacaaaatc
cgtgacacggccacttctcacgaacgtctgttcttcgttgaagtgatgggacgtgatgcc
ggtttcctggcattgaacggtgcgattgcttccggagcagaagctgccatcatccccgaa
ttcagtacagaagtcgaccaattggaagaatttataaagagcggtttccgtaaatcaaag
aacagcagtatcgtactggtagccgaaagcgaactcaccggaggagctatgcattatgcc
gaacgcgtgaaaaacgaataccctcaatacgacgtccgtgtcaccattttagggcacttg
cagcgcgggggtagtccgacggcacacgaccgtattttggccagccgtctaggcgcagcc
gctatcgacgctattatggaagatcaacgaaatgtcatgattggcattgaacacgacgag
attgtatacgttccgttcagtaaagccatcaagaatgataaacctgtcaagagagatctc
gtcaatgtattgagagaactgtctatttga

DBGET integrated database retrieval system