KEGG   Bacteroides fragilis YCH46: BF3749Help
Entry
BF3749            CDS       T00202                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF3749
   01230 Biosynthesis of amino acids
    BF3749
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF3749
   00030 Pentose phosphate pathway
    BF3749
   00051 Fructose and mannose metabolism
    BF3749
   00052 Galactose metabolism
    BF3749
  Energy metabolism
   00680 Methane metabolism
    BF3749
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BF3749
Enzymes [BR:bfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BF3749
Protein phosphatases and associated proteins [BR:bfr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BF3749
Messenger RNA biogenesis [BR:bfr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BF3749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4254522..4255511
Genome map
AA seq 329 aa AA seqDB search
MIVMGTVKCVGILTSGGDAPGMNAAIRAVTRAAIYNGLQVKGIYRGYRGLVTGEIKEFKS
QNVSNIIQLGGTILKTARCKEFTTPEGRKMAYDNMVKEGIDALVVIGGDGSLTGARIFAQ
EYDIPCIGLPGTIDNDLYGTDTTIGYDTALNTILDAVDKIRDTATSHERLFFVEVMGRDA
GFLALNGAIASGAEAAIIPEFSTEVDQLEEFIKSGFRKSKNSSIVLVAESELTGGAMHYA
ERVKNEYPQYDVRVTILGHLQRGGSPTAHDRILASRLGAAAIDAIMEDQRNVMIGIEHDE
IVYVPFSKAIKNDKPVKRDLVNVLRELSI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattgttatgggaacagttaagtgtgttggtattttaacttccggtggtgatgcaccg
ggaatgaacgctgctattcgtgcagtaacgcgtgcagcaatctacaacggactgcaagta
aaaggtatatatagaggatacagaggcttggtgacaggagagatcaaggagtttaagagc
cagaatgtaagtaacatcattcaactgggaggaacgatcctgaagacagcacgttgcaaa
gagtttacaactcccgaaggacgtaaaatggcatacgacaatatggtgaaagaaggaatc
gatgcccttgtagtgatcggtggcgacggttcgctgaccggagcacgcatctttgcacaa
gagtatgacattccatgcatcggacttccgggaaccatcgacaatgacctttacggcacc
gacacgaccatcggatacgatacggcgctgaacactattttggatgctgtcgacaaaatc
cgtgacacggccacttctcacgaacgtctgttcttcgttgaagtgatgggacgtgatgcc
ggtttcctggcattgaacggtgcgattgcttccggagcagaagctgccatcatccccgaa
ttcagtacagaagtcgaccaattggaagaatttataaagagcggtttccgtaaatcaaag
aacagcagtatcgtactggtagccgaaagcgaactcaccggaggagctatgcattatgcc
gaacgcgtgaaaaacgaataccctcaatacgacgtccgtgtcaccattttagggcacttg
cagcgcgggggtagtccgacggcacacgaccgtattttggccagccgtctaggcgcagcc
gctatcgacgctattatggaagatcaacgaaatgtcatgattggcattgaacacgacgag
attgtatacgttccgttcagtaaagccatcaagaatgataaacctgtcaagagagatctc
gtcaatgtattgagagaactgtctatttga

DBGET integrated database retrieval system