KEGG   Bacteroides fragilis YCH46: BF3749Help
Entry
BF3749            CDS       T00202                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00010  Glycolysis / Gluconeogenesis
bfr00030  Pentose phosphate pathway
bfr00051  Fructose and mannose metabolism
bfr00052  Galactose metabolism
bfr00680  Methane metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
bfr01120  Microbial metabolism in diverse environments
bfr01130  Biosynthesis of antibiotics
bfr01200  Carbon metabolism
bfr01230  Biosynthesis of amino acids
bfr03018  RNA degradation
Module
bfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF3749
   00030 Pentose phosphate pathway
    BF3749
   00051 Fructose and mannose metabolism
    BF3749
   00052 Galactose metabolism
    BF3749
  Energy metabolism
   00680 Methane metabolism
    BF3749
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BF3749
Enzymes [BR:bfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BF3749
Protein phosphatases and associated proteins [BR:bfr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BF3749
Messenger RNA biogenesis [BR:bfr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BF3749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-GeneID: 3084830
NCBI-ProteinID: YP_101025
UniProt: Q64PU0
Position
4254522..4255511
Genome map
AA seq 329 aa AA seqDB search
MIVMGTVKCVGILTSGGDAPGMNAAIRAVTRAAIYNGLQVKGIYRGYRGLVTGEIKEFKS
QNVSNIIQLGGTILKTARCKEFTTPEGRKMAYDNMVKEGIDALVVIGGDGSLTGARIFAQ
EYDIPCIGLPGTIDNDLYGTDTTIGYDTALNTILDAVDKIRDTATSHERLFFVEVMGRDA
GFLALNGAIASGAEAAIIPEFSTEVDQLEEFIKSGFRKSKNSSIVLVAESELTGGAMHYA
ERVKNEYPQYDVRVTILGHLQRGGSPTAHDRILASRLGAAAIDAIMEDQRNVMIGIEHDE
IVYVPFSKAIKNDKPVKRDLVNVLRELSI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattgttatgggaacagttaagtgtgttggtattttaacttccggtggtgatgcaccg
ggaatgaacgctgctattcgtgcagtaacgcgtgcagcaatctacaacggactgcaagta
aaaggtatatatagaggatacagaggcttggtgacaggagagatcaaggagtttaagagc
cagaatgtaagtaacatcattcaactgggaggaacgatcctgaagacagcacgttgcaaa
gagtttacaactcccgaaggacgtaaaatggcatacgacaatatggtgaaagaaggaatc
gatgcccttgtagtgatcggtggcgacggttcgctgaccggagcacgcatctttgcacaa
gagtatgacattccatgcatcggacttccgggaaccatcgacaatgacctttacggcacc
gacacgaccatcggatacgatacggcgctgaacactattttggatgctgtcgacaaaatc
cgtgacacggccacttctcacgaacgtctgttcttcgttgaagtgatgggacgtgatgcc
ggtttcctggcattgaacggtgcgattgcttccggagcagaagctgccatcatccccgaa
ttcagtacagaagtcgaccaattggaagaatttataaagagcggtttccgtaaatcaaag
aacagcagtatcgtactggtagccgaaagcgaactcaccggaggagctatgcattatgcc
gaacgcgtgaaaaacgaataccctcaatacgacgtccgtgtcaccattttagggcacttg
cagcgcgggggtagtccgacggcacacgaccgtattttggccagccgtctaggcgcagcc
gctatcgacgctattatggaagatcaacgaaatgtcatgattggcattgaacacgacgag
attgtatacgttccgttcagtaaagccatcaagaatgataaacctgtcaagagagatctc
gtcaatgtattgagagaactgtctatttga

DBGET integrated database retrieval system