KEGG   Bacteroides fragilis YCH46: BF3828Help
Entry
BF3828            CDS       T00202                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bfr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4368285..4370987
Genome map
AA seq 900 aa AA seqDB search
MIVTFHIEYRTSWGEEVRILGSVPELGKNNPEQAVALTTVDGIHWSNEISIQLPAEGVVE
YSYHIYRDGKAIRTEWNSFPRLIYLPADVKKSLRINDCWKNLPEQQYFYSSAFTEALLAH
CERSAIPKSYKKGLMIKAYAPRINSKYCLAICGNQKALGNWDPDKAWPMSDANFPEWQAE
LDASKLEFPLEYKFVLYNKEEKRAEAWENNPNRYLAAPEIKANETLVIADRYAYFNIPSW
KGAGVAVPVFSLKSEKSFGVGDFGDLKRMVDWAVSTNQKVVQILPINDTTMTHTWTDSYP
YNSISIYAFHPMYADLKQMGNLKDKETAATFNRKQKELNALSAIDYEAVNRVKWEYFHQI
FKQEGEKVLASKAFRSFFEANKDWLQPYAAFSYLRDLYHTPNFREWPQYSEYNAQEIEEL
CRPDTADYAHIAIYFYIQFNLHLQLLEATTYAREHGVVLKGDIPIGISRNSVEAWTEPYY
FNLNGQAGAPPDDFSVNGQNWGFPTYNWDVMENDGYKWWMKRFQKMAEYFDAYRIDHILG
FFRIWEIPMNAVHGLLGQFVPALPMSREEIESYGLSFREEFLRPYIHEYFLGQVFGPHTD
YVKQTFIEPTETYEVYRMRPEFDTQRKVEAFFAGKNDEDSIWVRDGLYALISDVLFVPDR
KDPNLYHPRIGVQHDFIYRALNDWEKTAFNRLYDQYYYHRHNDFWQQQAMKKLPQLTQST
RMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKNPAEEFGRLNEYPYRSVCTFSTHDM
STLRGWWEEDYQQTQRYYNQMLGHYGTAPAIATPELCEEVVRNHLYSNSILCILSLQDWL
SMDGKWRNPNVQEERINIPANPRHYWRYRMHLTLEQLMKAESLNEKIRELVKQTGRNPEK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgatagttacatttcatattgaatatcgcacaagctggggagaagaagtcagaatatta
ggttctgtccccgaacttgggaaaaataatccggagcaggctgtagcccttaccacagta
gacggcattcattggagcaatgaaatatccattcaattgccggccgaaggggttgtcgaa
tacagttatcacatatatcgtgacggtaaggccatccgtaccgaatggaactcctttccg
cgactcatctatctaccggccgacgttaagaaaagcctgcgcatcaatgactgctggaag
aatcttccggagcagcaatacttctacagttcggcatttaccgaagcactgctggcgcac
tgcgaacgaagcgcaatccccaaaagctacaaaaaaggattgatgatcaaggcttatgct
ccacgcatcaacagcaagtactgcctggccatctgtggtaaccagaaagcactcggcaac
tgggacccggacaaggcatggcccatgagtgatgccaactttccggaatggcaagccgaa
ctggatgcttccaaactggaatttccactagaatacaaatttgtattgtacaataaagaa
gagaagcgtgccgaagcttgggagaataaccccaaccgctatctggctgctcccgaaatc
aaagcaaacgagacattggtcattgccgaccgatatgcctactttaatattccttcctgg
aaaggtgcaggcgtagctgtccctgtattctcactaaagtcggaaaaaagtttcggtgta
ggagacttcggagacctgaagagaatggtggactgggcggtcagtaccaaccagaaggta
gtacagatcttaccgatcaacgataccaccatgactcatacatggacagactcttatccc
tacaacagcatttccatttatgccttccacccgatgtatgccgaccttaaacagatgggc
aacctgaaggataaagaaactgctgctaccttcaaccgaaaacaaaaagaactgaatgca
ctttccgccatcgactacgaagctgtcaaccgggtgaaatgggaatatttccatcagata
ttcaagcaagaaggagaaaaggtgctggcttcgaaagccttccgcagcttcttcgaagcc
aacaaagattggctgcaaccgtatgctgcattcagctacctgcgcgatttataccataca
ccgaacttccgcgaatggccccaatactcggagtacaatgctcaagagattgaagaactg
tgccgccccgacacggcggactatgcccatatcgccatctacttctatatccagttcaat
cttcacctgcaattgctcgaagccaccacttatgcccgcgagcatggagtagtgctgaag
ggggacatccccatcggtatcagtcgcaacagtgtcgaagcctggacagaaccttattat
ttcaacctcaacggacaggccggtgctccacccgatgatttctctgtcaacgggcagaac
tggggtttccccacctataactgggatgtgatggagaacgacggttataaatggtggatg
aaacgtttccaaaagatggctgaatactttgacgcctaccgcatcgaccacattctggga
ttcttccgcatctgggaaatcccgatgaatgccgtgcatggattgctgggacagtttgta
cccgcccttcccatgagccgtgaagagatagaaagttacggactctctttccgtgaagag
ttcctgcggccgtatatccatgaatatttcctcggacaagtgttcggaccacataccgac
tatgtaaagcagacgttcatcgaaccgactgaaacttacgaggtataccgtatgcgtccg
gaatttgatacccaacgcaaggtagaagccttctttgccggcaagaacgacgaagacagt
atatgggtcagagacggattatatgccctgatcagtgacgtattatttgttcccgaccgc
aaagacccgaacctgtaccatccccgcatcggcgtgcagcacgactttatctaccgtgcc
ctgaacgactgggaaaaaacagcattcaaccgcctttacgaccagtactactatcatcgt
cacaatgacttctggcaacagcaagccatgaagaaattgccacagcttacccagtctacc
cgcatgctggtatgtggcgaagacttaggcatgattcccgactgcgtggcatgggtgatg
aatgacttacgtatcctgagtctcgaaattcagcggatgcccaagaatccggcagaagaa
ttcggaaggctgaacgaatatccgtaccgttcggtctgcaccttctccacccacgatatg
tcgaccctgcggggctggtgggaagaagactatcagcagacccaacgctactacaatcag
atgctgggacattatggtaccgctcctgccatagcaacgccggagctgtgcgaagaagta
gtacgcaatcacctttacagcaattccatcctctgcatcctatccctgcaagactggctg
tcgatggatggaaaatggcgcaacccgaatgtacaggaagaacggatcaatatccccgcc
aatccgcgtcattactggcgctaccggatgcacctgacactggaacaactgatgaaagca
gaaagcctgaatgaaaaaatcagggaattggtgaagcagacaggcagaaatccggaaaag
taa

DBGET integrated database retrieval system