KEGG   Bacteroides fragilis YCH46: BF3886Help
Entry
BF3886            CDS       T00202                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BF3886
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BF3886
Enzymes [BR:bfr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BF3886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4424493..4425035)
Genome map
AA seq 180 aa AA seqDB search
MKAFFSFVAALVLSLSMAAQNKSFYDFTVKTIDGKEYPLSGLKGKKVLVVNVASKCGLTP
QYAELQELYDQYKDQNFVIIGFPANNFMGQEPGTNEEIAKFCSVNYDVTFPIMAKISVKG
KDMAPLYHWLTEKKLNGKQDAPVQWNFQKFMIDENGNWVGFVAPKESPFSETIISWIEKK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttttttctttcgtagcagccttggtactttcactgtcgatggctgctcag
aataaatcattctatgacttcacagtgaagaccatagatggcaaagagtatccactgtca
ggtctgaaaggtaagaaggtgctggtagtgaatgtcgcctccaagtgtggactgactccg
caatatgcagagttgcaggagttgtatgatcagtataaagatcagaattttgtgattatc
ggctttcctgccaataacttcatgggacaagagccggggacaaacgaagagatcgccaaa
ttttgttcggtgaactatgatgttaccttcccgataatggccaagatatcggtaaagggt
aaagatatggctccgctttaccactggttgacagagaagaagctgaacggaaagcaagat
gcgccggtacagtggaattttcagaagtttatgattgatgagaatggaaattgggttggt
tttgtagctcccaaagagagtcctttttcagagacgataatcagttggatagaaaaaaag
taa

DBGET integrated database retrieval system