KEGG   Bacteroides fragilis YCH46: BF3886Help
Entry
BF3886            CDS       T00202                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bfr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bfr00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4424493..4425035)
Genome map
AA seq 180 aa AA seqDB search
MKAFFSFVAALVLSLSMAAQNKSFYDFTVKTIDGKEYPLSGLKGKKVLVVNVASKCGLTP
QYAELQELYDQYKDQNFVIIGFPANNFMGQEPGTNEEIAKFCSVNYDVTFPIMAKISVKG
KDMAPLYHWLTEKKLNGKQDAPVQWNFQKFMIDENGNWVGFVAPKESPFSETIISWIEKK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttttttctttcgtagcagccttggtactttcactgtcgatggctgctcag
aataaatcattctatgacttcacagtgaagaccatagatggcaaagagtatccactgtca
ggtctgaaaggtaagaaggtgctggtagtgaatgtcgcctccaagtgtggactgactccg
caatatgcagagttgcaggagttgtatgatcagtataaagatcagaattttgtgattatc
ggctttcctgccaataacttcatgggacaagagccggggacaaacgaagagatcgccaaa
ttttgttcggtgaactatgatgttaccttcccgataatggccaagatatcggtaaagggt
aaagatatggctccgctttaccactggttgacagagaagaagctgaacggaaagcaagat
gcgccggtacagtggaattttcagaagtttatgattgatgagaatggaaattgggttggt
tttgtagctcccaaagagagtcctttttcagagacgataatcagttggatagaaaaaaag
taa

DBGET integrated database retrieval system