KEGG   Bacteroides fragilis YCH46: BF3897Help
Entry
BF3897            CDS       T00202                                 

Definition
beta-galactosidase precursor
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4441633..4443942)
Genome map
AA seq 769 aa AA seqDB search
MKKLILLLILIFSLPVAAQNFTIGKSTFLLNGKPFTVKAAELHYTRIPAPYWEHRIEMCK
ALGMNTICLYVFWNIHEQTEGQFDFTGQNDIAAFCRLAQKHGMYVIVRPGPYVCAEWEMG
GLPWWLLKKKDIVLRTLDPYFMERTAIFMKEVGKQLAPLQITRGGNIIMVQVENEYGAYA
VDKPYVSAIRDIVKSAGFTEVPLFQCDWSSTFDRNGLDDLLWTINFGTGANIEQQFKRLR
EARPETPLMCSEFWSGWFDHWGRKHETRPAKSMVQGIKDMLDRNISFSLYMAHGGTTFGH
WGGANNPSYSAMCSSYDYDAPISEPGWTTDKYFQLRDLLKNYLPAGEQLPEIPEAFPVIE
IPEVEFTQIAPLFSNLPEAKESMDIQPMEAFDQGWGTILYRTTLQEPVENGTTMKITEVH
DWAQVFADGKLLARLDRRRGEFALQLPALKKGTRIDILVEAMGRVNFDESIHDRKGITEK
VELVRGKQSAELKNWTVYSFPVDYSFVQDKRYKNGTAQTMPAYYRTTFRLDKVGDTFLDM
STWGKGMVWVNGLAIGRFWEIGPQQTLFMPGCWLKEGENEIIVLDLKGPEKASIRGLKKP
ILDWLRNEGASTHRKEGEQLDLSRETPVAEGTFVPGNGWQEVCFDRQSTGRYFCLEALSA
QKGKKIAAIAELDVLGADGKPISREKWRIRYADSEETRSGNCTGDKVFDLQESTYWMTVA
KDAYPHQLVIDLGGDYTVTGFRYLPRAEKGYPGMIKDYRVYVKGEDFQY
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgattctgcttctcattttgattttttcgttgcctgttgcagcacaaaat
ttcacaatcgggaagagcactttccttttgaatggcaagccttttacggttaaggctgcc
gagttgcattatacccgtattccggctccttactgggagcatcgtatcgagatgtgtaag
gcattggggatgaatacgatttgtctttatgtattttggaacatccatgaacagactgag
ggacagtttgactttaccggacaaaatgatatagccgctttttgccgtctggctcagaag
catgggatgtatgtgattgtacgcccgggtccttatgtttgtgccgaatgggagatgggc
ggacttccttggtggttactgaagaagaaagatattgtacttcgtacactcgatccttat
tttatggagcgcactgcaatctttatgaaagaagtcggaaaacagcttgcaccgttgcag
attactcgcggaggaaacattatcatggtgcaggtagaaaatgaatatggtgcttatgca
gttgacaaaccctatgtttcggctattcgtgatatagtgaaaagtgccgggtttaccgaa
gttcctctttttcaatgtgactggagcagtacctttgatcggaatggattggacgatttg
ctctggactatcaattttggtacgggagccaacattgaacagcagttcaagcgtctcaga
gaggctcgtccggagactccattaatgtgtagtgagttctggagtggatggtttgatcat
tggggacgcaagcatgagacccgtcctgccaaaagcatggtgcagggtatcaaagatatg
cttgaccgtaatatttcattcagtctctatatggcccatggaggtactactttcgggcat
tggggtggtgccaacaatccgtcttactccgctatgtgtagttcttacgattacgatgcg
cctatcagtgagccgggatggactacggacaaatatttccagcttcgtgatctgctgaaa
aattatctgcctgcaggagaacaattgcctgagattcccgaagcttttccggtgattgag
atacctgaagtggagtttactcagattgctcccctcttttccaatttgcccgaggctaaa
gagagtatggatatacaaccgatggaggcttttgatcaggggtggggaacgattttgtat
cggactactttgcaggagcctgtcgaaaatggcactacgatgaagatcacagaggtacat
gattgggcacaagtttttgccgatggtaaattgttggctcgtctggatcgtcgtcgtggt
gaatttgccttgcaactgccggctttgaagaaagggacgcgtatcgacatcctggtagaa
gctatgggacgcgttaactttgatgagtcgattcacgatcgcaaaggtatcactgaaaaa
gtagaacttgtccgtggaaagcaatctgcagagttaaagaattggacggtttatagtttt
ccggtggattattcgtttgtgcaagataaaagatataaaaatgggacagctcagactatg
cctgcgtattataggactaccttccgtttggataaagttggcgatacgttccttgacatg
agtacttggggtaaaggtatggtatgggttaacggccttgctatcggacgtttctgggag
attggtccgcagcagacactcttcatgcccggttgttggctcaaagagggagaaaatgaa
attattgttcttgatttgaaaggccctgagaaagcatctatccgcggactgaagaagccc
atcttggattggttacgcaatgaaggggcttctacccatcgcaaagagggtgaacaactg
gacttgagtcgggaaactcccgttgccgaaggtacgtttgttccgggcaacggatggcag
gaagtttgctttgatcgtcagagtaccggtcgttatttctgccttgaggccctttcggca
caaaaaggaaagaagatagcagccatcgccgaactcgatgtactgggtgccgacggtaag
ccaatttcacgtgaaaagtggagaatacgctatgccgacagcgaagagacacgtagcggt
aactgtacgggagataaagtgttcgatcttcaggaatccacttactggatgacggtggct
aaagatgcttatcctcatcaattagtcatcgatctgggtggagactataccgtaaccggt
ttccgctatttgccccgtgccgaaaagggatatcccggcatgataaaagattaccgggtg
tacgtcaaaggggaagattttcaatactga

DBGET integrated database retrieval system