KEGG   Bacteroides fragilis YCH46: BF3954Help
Entry
BF3954            CDS       T00202                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BF3954
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BF3954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4510469..4511053)
Genome map
AA seq 194 aa AA seqDB search
MLEKEEIISPALEDLKNHYRSIITLLGEDAEREGLLKTPERVAKAMLTLTKGYHMDPHEV
LRSAKFQEEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFS
HRLQVQERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQ
AKTREEFMNLIRQR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaagaagaaatcatttctccggctttggaagatttaaagaatcactatcgc
agtataattactttgttgggcgaagatgctgaacgggaaggattattaaaaactcccgaa
cgtgtagctaaagccatgttgaccttgaccaaaggctaccacatggacccgcatgaagtt
cttcgttctgccaagtttcaggaagagtacagtcagatggtgattgtgaaggatatagat
ttcttctcactttgcgaacaccacatgttgcctttctatggcaaagctcatgtagcttat
atacctaacggatatatcaccggattaagtaaaatagcccgtgtggtcgatattttctct
catcggctgcaagtgcaggaacggatgacgctgcaaattaaagagtgtattcaggaaacg
ttgaatccgctgggcgtaatggtcgtggtggaagccaagcatatgtgtatgcagatgcgc
ggagtggaaaaacagaattccgtaactactacttccgactttacaggagcttttaatcag
gctaagacccgtgaagagtttatgaacctgatccgccagagatga

DBGET integrated database retrieval system