KEGG   Bacteroides fragilis YCH46: BF3956Help
Entry
BF3956            CDS       T00202                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF3956
   01230 Biosynthesis of amino acids
    BF3956
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF3956
   00051 Fructose and mannose metabolism
    BF3956
   00562 Inositol phosphate metabolism
    BF3956
Enzymes [BR:bfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BF3956
Exosome [BR:bfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BF3956
  Exosomal proteins of bladder cancer cells
   BF3956
  Exosomal proteins of melanoma cells
   BF3956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4511582..4512337)
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKI
GVGAENCADKESGAYTGEVSAAMVASTGAKYVILGHSERRAYYGETVEILKDKVKLALAN
GLTPIFCIGEVLEEREANKQNEVVAAQLASVFDLSAEDFSKIVLAYEPVWAIGTGKTASP
AQAQEIHAFIRSAVAEKYGKEIADNTSILYGGSCKPSNAKELFANPDVDGGLIGGAALKV
ADFKGIIDAFN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaacattgttgcaggaaactggaaaatgaacaaaacccttcaggagggtatt
gctcttgcaaaagaactgaatgaagctttggctaacgaaaagcctaactgtgatgtcatt
atctgtactccgtttattcaccttgcttctgttactcccttggtagatgcagctaagatc
ggtgtaggtgctgagaactgtgctgacaaagaatccggagcttatacaggtgaagtatcg
gctgctatggtagcttctaccggtgctaaatacgttattctgggtcactcggaacgtcgt
gcttactatggtgaaacggttgagatcctgaaggacaaagtgaaactggctttggcaaat
ggtctgactccgattttctgtatcggtgaggttctggaagaacgcgaggctaacaaacag
aacgaggttgttgctgctcagttggcatctgtattcgatctttcggcggaagatttctct
aagatcgttctggcttacgaaccggtttgggctatcggtaccggtaaaacagcttctcct
gctcaggctcaggaaatccatgcgttcatccgttcggctgttgctgagaaatacggaaaa
gaaatcgctgacaacacttcaatcctttatggtggtagctgcaaaccttctaatgctaaa
gaactgtttgctaaccctgatgttgacggtggtctgatcggtggtgctgccctgaaagtt
gctgacttcaaaggtatcattgacgcattcaattaa

DBGET integrated database retrieval system