KEGG   Bacteroides fragilis YCH46: BF4250Help
Entry
BF4250            CDS       T00202                                 

Definition
beta-hexosaminidase precursor
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfr00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bfr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4849425..4851785
Genome map
AA seq 786 aa AA seqDB search
MNIKKSILFLCAGIFLISSLSCREGGHVAKSYNAGINIIPTPRSLEKREGSFKLSDGVSI
GAITPEAKKIATYFAAKISLATGYDVKVEDKGEITLVLDSCATFSPEGYALDVESSRVQV
TACSPRGLFYGMQSFLQLLPAEIESAGIVRDVDWEAPAANIIDSPRFAYRGIHMDPCRHF
MTVEEVKKQIDVLSMFKINTIHWHLTDDQGWRIEIKQYPGLAEIGGRRIEGEGVEYGPFY
YTQEEIKDIVSYAAERFITIIPELEIPGHELAAISAYPGLSCKGDPVTPRNIWGVEDIVM
CPGKESVFTFLENVIDEMVALFPGTYFHIGGDECPKESWKSCPLCQKRILEEGIKPDGKH
TSEQLLHTYVVERIGKYLARYDKKIIGWDEILEGKPDSTATIMSWRGDAGGISAALSGHD
AIMSPGPNGLYLDYYQGDSKIEPIAIGGCSTLEKVYNYNPVPDTLVLIGKDHHIIGVQAN
NWSEYFYNNDIREYHMYPRSLALAEVAWTDAKRKNYVDFERRINNAYVRLDGHGVNYHIP
LPEQPGGSCDHIAFTDSVSLEFTTSRPISLVYTLDGTEPGVSSEIYTSPLSFYQNGILKI
ASLLSSGKLSKVRTIQIEKQVLLPAVDVEGSFHGLNMEVTYGMFLNMQEFMKTGKSVDVS
TDIRETGELTSFVPSTNSMRDVRQYAAVATGFIDIPENGVYFFSSDLEEVWVGGKLLVNN
GGEVKRHSRNDRSIALEKGMHELKLVFLGHIIGGWPSNWNNGVVMLRKSDEKKFRKITSD
MLWRKK
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaaaaaagtatcttgtttttatgcgcaggcatattcttgatttcgtcactc
tcgtgtagagagggcggacatgttgcgaaatcatataatgccggcattaatatcattccc
acgccccgctctttagaaaagcgtgagggaagtttcaaattgtccgatggtgtttctata
ggagccattacccctgaggcaaaaaagattgcaacgtattttgccgctaaaatcagtctg
gcaaccgggtacgatgtcaaggtggaggataaaggagaaattactctagtactggattct
tgtgcaacgttctctccggaaggctatgcattggatgtggaatcatcccgtgtgcaggta
acagcgtgttctccccggggattattttacgggatgcagagttttctgcagttgcttccg
gcagaaatagaaagtgccgggatcgtgcgggatgttgactgggaggctcctgccgccaat
attatcgactcgccacgttttgcataccgcggaatacatatggatccttgccgccatttt
atgacggttgaagaagtgaagaagcagatagatgttttatccatgttcaaaataaatacg
attcactggcatctgacggacgaccagggatggcgtattgaaataaaacaatatccagga
ttggcggagatcggcggcaggcgtattgaaggggaaggcgtggaatacggccccttttat
tatactcaggaagagatcaaggacattgtctcgtatgcggccgagcgttttatcaccatt
attccggaattagaaattccgggacatgaacttgcggctatatccgcctatcccgggctg
tcctgtaagggagaccccgttacccctcggaatatttggggagtggaggatatcgtaatg
tgtccgggtaaggagagtgtttttacattcctggaaaatgtcattgatgagatggttgcc
ctttttccgggcacctatttccatattggcggtgatgaatgccccaaagagagttggaag
tcctgtcccctttgtcagaagcgtattctggaggagggaataaagcctgatggcaagcat
acttcagagcagttgctgcatacttacgttgtggagcgcatagggaaatatttagcccga
tatgataaaaaaataatcggttgggatgagattctggaaggcaagcctgactccacggcg
accattatgtcatggcggggtgatgccggcggtatatcggccgctttatcgggacatgat
gcgataatgtctcccggtccgaacgggctctatctggattattatcagggggacagcaag
attgagcctatagctatcggcggttgttcgactttggaaaaagtgtataattacaatccc
gtacccgacacattggtgcttattgggaaggaccatcatataataggggttcaggctaat
aattggagtgaatatttttataataatgatatccgtgagtatcacatgtatccccgttcc
ttggctttggcggaagtcgcctggactgatgccaaacgcaagaattacgtggattttgaa
cggcgtatcaacaacgcgtatgtccgtctggacggacatggcgtcaattaccacattcca
ttgccggagcagccgggcggttcttgtgaccatatcgcttttacagacagtgtgtctctg
gaatttaccacgagccgtcctattagcttagtttatacgcttgacggtactgaacctgga
gtatcctcggaaatttatacttctcctctttctttttatcagaacggtatccttaagatc
gcttcgttgctatcctctggaaaactgagcaaagtgcgtacaatccagatagagaagcag
gtacttttgcctgctgtggatgtagaagggagttttcatgggttaaatatggaagtgaca
tacggtatgtttcttaatatgcaggagtttatgaaaacgggcaagagtgtggatgtcagt
acggatatcagagaaacgggggaattaacgtcattcgtgccttctacgaattctatgcga
gacgtaagacaatatgctgctgtggccactggatttattgatattcctgaaaatggtgtt
tactttttctcctctgatctggaagaggtttgggtcggcggaaaattacttgtaaacaat
ggtggagaggtgaaacgtcattcccgaaatgaccgctccattgctttggagaaggggatg
catgagttgaaactcgttttcttggggcacatcatcggaggatggccttcgaactggaat
aacggagttgtcatgctgcgaaagtctgatgagaaaaaattccgaaaaataacaagtgac
atgctttggagaaaaaagtag

DBGET integrated database retrieval system