KEGG   Bacteroides fragilis YCH46: BF4385Help
Entry
BF4385            CDS       T00202                                 

Definition
aldose 1-epimerase precursor
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5010883..5012022
Genome map
AA seq 379 aa AA seqDB search
MNRMKTKLIILLILTTMIHTNTVNAQHSQLKRADFQQTIDGKQTDLYFLRNKNGIEIAIT
NFGGRVVEFWTPDKKGHFEDIVLGHDHVDKYLHYKGERFLGATIGRYGNRINKGKFTLNG
QTYQLPINDTPNSLHGGFKGFDMVVWDVEQPDSQTLQLTYLSKDGEEGYPGNLQVSMSYK
LTDKNEFIITHQAQTDKETVINLTHHSFFNLHGAGNKDINDHILMINADKFTPVDQTLIP
TGILQDVEGTPMDFRRPTPIGKRVNDSFEQLEFGHGYDHNWVLNRKTSNTPELAATVYEP
ASGRYLEVWTTEPGLQFYGGNFFDGTMTGKHEKKYNYRASLALETQHYPDSPNQPAFPST
TLLPGDTYKHICIYKINVQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatgaaaacaaaactgatcattttattaatactcacaaccatgatacacaca
aacaccgtaaatgcccaacattcacaattgaaaagagccgattttcaacaaacaattgac
ggaaagcaaaccgatctctactttctgagaaacaaaaacggcattgaaattgccatcacc
aatttcggaggacgagtcgttgaattctggactccggataaaaaagggcattttgaagac
atcgtcctcggacacgatcatgtggacaaatatctccattataaaggtgaaagatttttg
ggagccactatcggacggtatggcaaccggatcaacaaaggaaagtttaccctgaacgga
caaacttaccagttacccatcaatgatactcccaacagtctacatggtggctttaaagga
tttgatatggtagtatgggatgttgagcagccggacagccagactttacaactcacgtat
ttatccaaagatggtgaagaggggtatccgggaaatctccaagtatccatgagttacaaa
cttacggataaaaacgaatttattatcactcaccaggctcaaacagacaaagaaacggtc
atcaacctcacccatcattccttcttcaacctgcacggtgcaggcaataaggatatcaat
gaccatatactcatgatcaatgcggataagtttactcctgtcgatcagaccctaatcccc
accggtattctccaggatgtagaagggaccccgatggattttcgtcgccccacacctatc
ggaaagcgagtaaatgattcgttcgagcaactggagttcggtcacggctacgaccataat
tgggtcttgaatcgcaaaacctccaacacccccgaactggcagcaaccgtttatgaaccc
gcctcaggaagatatcttgaagtatggaccaccgaacccggactacaattctatggcggt
aacttctttgatggtacaatgaccggaaagcacgaaaagaaatacaactaccgggcttcc
ctcgcattggaaacccagcactatccggatagtcctaaccaaccggcattcccgtcaaca
accctcttacccggagatacttacaaacatatatgcatctataaaatcaatgtacaatga

DBGET integrated database retrieval system