KEGG   Bacteroides fragilis YCH46: BF4586Help
Entry
BF4586            CDS       T00202                                 

Definition
leucyl-tRNA synthetase
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bfr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5270961..5273792
Genome map
AA seq 943 aa AA seqDB search
MEYNFREIEKKWQKIWVDNHTYQVNEDASKQKFYVLNMFPYPSGAGLHVGHPLGYIASDI
YARYKRLQGFNVLNPMGYDAYGLPAEQYAIQTGQHPAITTVNNINRYREQLDKIGFSFDW
NREIRTCDPEYYHWTQWAFIKMFNSYYCNDEKQARPIEELIEAFSTNGTQGMNVACGEEM
DFTADEWNAKSEKEQQEILMNYRIAYLGNTMVNWCPALGTVLANDEVVDGVSERGGYPVI
QKVMRQWCLRVSAYAQRLLDGLETVEWTDSLKETQRNWIGRSEGAEMNFKVKDSDIEFTI
FTTRADTVFGVTFMVLAPESELVAKLTTPEQKAEVDAYLDRTKKRTERERIADRSVSGVF
SGSYAINPLTNEPIPVWISDYVLAGYGTGAIMAVPAHDSRDYAFAKHFNLEIRPLIEGCD
VSEESFDAKEGIMMNSPRPGAPEGGLVLNGLTVKEAIAKTKEYIKATGLGRVKVNFRLRD
AIFSRQRYWGEPFPVYYKDGMPYMIDESCLPLELPEVAKFLPTETGEPPLGHATKWAWDT
VNKCVTDNENIDNRTIFPLELNTMPGFAGSSAYYLRYMDPRNHEALVSPAVDQYWKNVDL
YVGGTEHATGHLIYSRFWNKFLHDWGISVAEEPFQKLVNQGMIQGRSNFVYRIKDTNTFV
SLNLKDQYEVTPIHVDVNIVSNDILDLEAFKAWRPEYETAEFILEDGKYICGWAVEKMSK
SMFNVVNPDMIVEKYGADTLRMYEMFLGPVEQSKPWDTNGIDGVHRFIKKFWSLFYDRNG
EYLVKDEPATKEELKALHKLIKKVTGDIEQFSYNTSVSAFMICVNELSSLKCNKKEVLEQ
LIVVLAPFAPHVCEELWDTLGNTTSVCDAQWPTFNEQYLVEDTVNYTISFNGKARFNMEF
PADAASDAIQATVLADERSLKWTEGKTPKKVIVVPKKIVNIVI
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggaatataatttcagggagatcgaaaagaaatggcagaaaatttgggtagacaaccat
acctaccaggtaaatgaagatgcatccaaacaaaaattctatgtactcaatatgttcccc
tatccttcgggtgccggactgcacgtaggtcatcccctgggatatattgcctcagacatt
tatgcgcgctataaacgcctgcaaggatttaacgtattgaacccgatgggatatgatgct
tacggactgccggccgaacaatatgctattcaaaccggacagcaccctgcaattaccact
gttaataacatcaaccgctatcgtgaacaattagataagattggtttctctttcgactgg
aatcgtgaaattcgcacttgcgatccggaatattatcattggacccaatgggcatttatc
aaaatgttcaacagctattattgcaatgatgaaaaacaggcacgtcccatcgaagagtta
atagaagcttttagtaccaacggaacacaaggtatgaacgtagcctgtggcgaagaaatg
gacttcactgccgacgaatggaatgctaaaagcgaaaaagaacaacaggaaatcctcatg
aactaccgtatagcctatttgggcaatacaatggtaaactggtgtccggctttgggtacc
gtacttgccaatgatgaagtagttgacggtgtttccgaaagaggcggttatcccgttatt
caaaaagtgatgcgtcagtggtgcctgcgcgtatccgcttatgcacagcgtttgctcgac
ggacttgaaaccgtagaatggaccgactcgctgaaagagactcaacgcaactggatagga
cgcagcgaaggtgctgaaatgaactttaaagtgaaagattcggatattgaatttactatc
tttacaacccgtgccgacacggtatttggagttactttcatggtgcttgccccggaaagt
gaattggtagccaagttgaccactccggaacaaaaagccgaagtagatgcttatctggac
cgtaccaaaaaacgtaccgaacgcgaacgtattgccgaccgtagcgtaagcggcgtattc
tccggaagctatgccattaacccattgaccaacgaacccataccggtatggattagcgat
tatgtattagcaggttacggtacaggtgccatcatggctgttcctgcacacgatagccgt
gactatgcttttgccaaacatttcaatctggaaatccgtccgctgatcgaaggttgcgac
gtcagtgaagaaagcttcgacgccaaagaaggcatcatgatgaattctccccgtccggga
gctcccgaaggcggactcgtattgaacggattgaccgtaaaagaagcaatcgccaaaact
aaagaatatatcaaggcaaccggattaggccgtgtgaaagtcaatttccgtctgcgtgat
gcaattttctcacgtcagcgctattggggcgaaccattcccggtttactacaaagacgga
atgccttacatgattgatgaaagttgcctcccgctggaattgccggaagtagccaaattc
cttcctaccgaaaccggtgaaccaccattgggacatgccactaaatgggcatgggacact
gtcaacaaatgcgtgactgacaatgaaaacattgataatagaaccattttcccactggaa
ctgaatacgatgccgggatttgccggttcatccgcctattatctgcgctatatggatccg
cgcaatcacgaagctctcgtttctcccgccgtggatcagtactggaaaaatgtagactta
tatgtaggaggtacggaacatgctaccggacacttgatttattcacgtttctggaataag
ttcctgcacgattggggtatctccgtagccgaagagcctttccagaaacttgtaaatcag
ggaatgatacaaggacgaagtaactttgtctaccgtatcaaggataccaatactttcgta
tctctcaatctgaaagatcaatatgaagttactcctatccacgtagatgtcaacatcgta
tccaacgatatcctcgacctggaagctttcaaggcttggagacccgaatacgaaactgcc
gaatttattctggaagacggcaagtatatctgtggatgggctgttgaaaagatgagtaaa
tctatgttcaatgtggtaaatccggatatgattgttgaaaaatacggtgccgatacactc
cgtatgtacgaaatgttcctcggaccggttgaacagtccaaaccttgggatacgaacgga
atagatggcgtacatcgtttcatcaaaaaattctggtcattgttctatgacagaaacggc
gaatatctggtaaaagacgaaccggctaccaaagaagaactaaaagcactccataagttg
attaagaaagtaaccggtgatatcgaacagttctcttacaacacttcagtaagtgctttc
atgatctgtgtcaatgaactttcaagtctgaaatgcaataaaaaagaggtattggagcaa
ctcatcgtagttcttgcaccttttgctccgcatgtatgcgaagagttatgggatacactg
ggaaacaccacctctgtatgcgatgcacaatggccgactttcaacgagcaatacctggta
gaagatacggttaattacaccatttctttcaatggtaaagcacgtttcaatatggaattt
ccggctgatgccgccagcgatgcgattcaagccactgtacttgccgacgaacgctcgtta
aaatggacagaaggcaaaacaccgaagaaagttatcgtagtcccgaagaagattgttaac
attgttatttaa

DBGET integrated database retrieval system