KEGG   Bacteroides fragilis YCH46: BF4586Help
Entry
BF4586            CDS       T00202                                 

Definition
leucyl-tRNA synthetase
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BF4586
Enzymes [BR:bfr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     BF4586
Amino acid related enzymes [BR:bfr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BF4586
Transfer RNA biogenesis [BR:bfr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BF4586
 Prokaryotic Type
    BF4586
Mitochondrial biogenesis [BR:bfr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BF4586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5270961..5273792
Genome map
AA seq 943 aa AA seqDB search
MEYNFREIEKKWQKIWVDNHTYQVNEDASKQKFYVLNMFPYPSGAGLHVGHPLGYIASDI
YARYKRLQGFNVLNPMGYDAYGLPAEQYAIQTGQHPAITTVNNINRYREQLDKIGFSFDW
NREIRTCDPEYYHWTQWAFIKMFNSYYCNDEKQARPIEELIEAFSTNGTQGMNVACGEEM
DFTADEWNAKSEKEQQEILMNYRIAYLGNTMVNWCPALGTVLANDEVVDGVSERGGYPVI
QKVMRQWCLRVSAYAQRLLDGLETVEWTDSLKETQRNWIGRSEGAEMNFKVKDSDIEFTI
FTTRADTVFGVTFMVLAPESELVAKLTTPEQKAEVDAYLDRTKKRTERERIADRSVSGVF
SGSYAINPLTNEPIPVWISDYVLAGYGTGAIMAVPAHDSRDYAFAKHFNLEIRPLIEGCD
VSEESFDAKEGIMMNSPRPGAPEGGLVLNGLTVKEAIAKTKEYIKATGLGRVKVNFRLRD
AIFSRQRYWGEPFPVYYKDGMPYMIDESCLPLELPEVAKFLPTETGEPPLGHATKWAWDT
VNKCVTDNENIDNRTIFPLELNTMPGFAGSSAYYLRYMDPRNHEALVSPAVDQYWKNVDL
YVGGTEHATGHLIYSRFWNKFLHDWGISVAEEPFQKLVNQGMIQGRSNFVYRIKDTNTFV
SLNLKDQYEVTPIHVDVNIVSNDILDLEAFKAWRPEYETAEFILEDGKYICGWAVEKMSK
SMFNVVNPDMIVEKYGADTLRMYEMFLGPVEQSKPWDTNGIDGVHRFIKKFWSLFYDRNG
EYLVKDEPATKEELKALHKLIKKVTGDIEQFSYNTSVSAFMICVNELSSLKCNKKEVLEQ
LIVVLAPFAPHVCEELWDTLGNTTSVCDAQWPTFNEQYLVEDTVNYTISFNGKARFNMEF
PADAASDAIQATVLADERSLKWTEGKTPKKVIVVPKKIVNIVI
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggaatataatttcagggagatcgaaaagaaatggcagaaaatttgggtagacaaccat
acctaccaggtaaatgaagatgcatccaaacaaaaattctatgtactcaatatgttcccc
tatccttcgggtgccggactgcacgtaggtcatcccctgggatatattgcctcagacatt
tatgcgcgctataaacgcctgcaaggatttaacgtattgaacccgatgggatatgatgct
tacggactgccggccgaacaatatgctattcaaaccggacagcaccctgcaattaccact
gttaataacatcaaccgctatcgtgaacaattagataagattggtttctctttcgactgg
aatcgtgaaattcgcacttgcgatccggaatattatcattggacccaatgggcatttatc
aaaatgttcaacagctattattgcaatgatgaaaaacaggcacgtcccatcgaagagtta
atagaagcttttagtaccaacggaacacaaggtatgaacgtagcctgtggcgaagaaatg
gacttcactgccgacgaatggaatgctaaaagcgaaaaagaacaacaggaaatcctcatg
aactaccgtatagcctatttgggcaatacaatggtaaactggtgtccggctttgggtacc
gtacttgccaatgatgaagtagttgacggtgtttccgaaagaggcggttatcccgttatt
caaaaagtgatgcgtcagtggtgcctgcgcgtatccgcttatgcacagcgtttgctcgac
ggacttgaaaccgtagaatggaccgactcgctgaaagagactcaacgcaactggatagga
cgcagcgaaggtgctgaaatgaactttaaagtgaaagattcggatattgaatttactatc
tttacaacccgtgccgacacggtatttggagttactttcatggtgcttgccccggaaagt
gaattggtagccaagttgaccactccggaacaaaaagccgaagtagatgcttatctggac
cgtaccaaaaaacgtaccgaacgcgaacgtattgccgaccgtagcgtaagcggcgtattc
tccggaagctatgccattaacccattgaccaacgaacccataccggtatggattagcgat
tatgtattagcaggttacggtacaggtgccatcatggctgttcctgcacacgatagccgt
gactatgcttttgccaaacatttcaatctggaaatccgtccgctgatcgaaggttgcgac
gtcagtgaagaaagcttcgacgccaaagaaggcatcatgatgaattctccccgtccggga
gctcccgaaggcggactcgtattgaacggattgaccgtaaaagaagcaatcgccaaaact
aaagaatatatcaaggcaaccggattaggccgtgtgaaagtcaatttccgtctgcgtgat
gcaattttctcacgtcagcgctattggggcgaaccattcccggtttactacaaagacgga
atgccttacatgattgatgaaagttgcctcccgctggaattgccggaagtagccaaattc
cttcctaccgaaaccggtgaaccaccattgggacatgccactaaatgggcatgggacact
gtcaacaaatgcgtgactgacaatgaaaacattgataatagaaccattttcccactggaa
ctgaatacgatgccgggatttgccggttcatccgcctattatctgcgctatatggatccg
cgcaatcacgaagctctcgtttctcccgccgtggatcagtactggaaaaatgtagactta
tatgtaggaggtacggaacatgctaccggacacttgatttattcacgtttctggaataag
ttcctgcacgattggggtatctccgtagccgaagagcctttccagaaacttgtaaatcag
ggaatgatacaaggacgaagtaactttgtctaccgtatcaaggataccaatactttcgta
tctctcaatctgaaagatcaatatgaagttactcctatccacgtagatgtcaacatcgta
tccaacgatatcctcgacctggaagctttcaaggcttggagacccgaatacgaaactgcc
gaatttattctggaagacggcaagtatatctgtggatgggctgttgaaaagatgagtaaa
tctatgttcaatgtggtaaatccggatatgattgttgaaaaatacggtgccgatacactc
cgtatgtacgaaatgttcctcggaccggttgaacagtccaaaccttgggatacgaacgga
atagatggcgtacatcgtttcatcaaaaaattctggtcattgttctatgacagaaacggc
gaatatctggtaaaagacgaaccggctaccaaagaagaactaaaagcactccataagttg
attaagaaagtaaccggtgatatcgaacagttctcttacaacacttcagtaagtgctttc
atgatctgtgtcaatgaactttcaagtctgaaatgcaataaaaaagaggtattggagcaa
ctcatcgtagttcttgcaccttttgctccgcatgtatgcgaagagttatgggatacactg
ggaaacaccacctctgtatgcgatgcacaatggccgactttcaacgagcaatacctggta
gaagatacggttaattacaccatttctttcaatggtaaagcacgtttcaatatggaattt
ccggctgatgccgccagcgatgcgattcaagccactgtacttgccgacgaacgctcgtta
aaatggacagaaggcaaaacaccgaagaaagttatcgtagtcccgaagaagattgttaac
attgttatttaa

DBGET integrated database retrieval system