KEGG   Bacteroides fragilis NCTC9343: BF0071Help
Entry
BF0071            CDS       T00239                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BF0071
Enzymes [BR:bfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BF0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
68888..69349
Genome map
AA seq 153 aa AA seqDB search
MKVYLGLGTNLGDKELNLRVALQKIEERIGKIISLSAFYATAPWGFQSENNFLNAAVGVE
TVLSPVGILESTQRIEQEIGRLHKSRDGVYSDRLIDIDLLLYGDKILQDESLIVPHPLMT
DRKFVLEPLAEIAPDVVHPVFHKTIKELFLALS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatatttgggattaggtaccaacttgggtgataaggagctaaatcttcgtgtt
gccctacaaaaaatagaggagcggatagggaaaatcatttctctttccgctttttatgct
actgctccctggggatttcagtcggaaaacaactttctgaatgctgcggtgggagtggag
acagtattgtcccctgtcgggatactggaaagtactcaacggatagagcaggaaataggg
cgtttgcataaatcacgggacggtgtgtatagtgaccgcctgattgatattgatcttttg
ctctatggcgataagatactacaggatgaaagtcttatagtgcctcatccgttgatgacc
gaccgtaagtttgttctggaaccccttgccgagattgcaccggacgttgttcatccggtg
tttcataagacgattaaagagctatttctggctctttcgtga

DBGET integrated database retrieval system