KEGG   Bacteroides fragilis NCTC9343: BF0211Help
Entry
BF0211            CDS       T00239                                 

Gene name
fucI
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bfs00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
228141..229913
Genome map
AA seq 590 aa AA seqDB search
MKKYPKIGIRPTIDGRQGGVRESLEEKTMNLAKAVAELITSNLKNGDGTPVECVIADGTI
GRVAESAACAEKFEREGVGATITVTSCWCYGAETMDMNPYYPKAVWGFNGTERPGAVYLA
AVLAGHAQKGLPAFGIYGRDVQDLNDNSIPADVAEKILRFARAAQAVATMRGKSYLSMGS
VSMGIAGSIVNPDFFQEYLGMRNESIDLTEIIRRMAEGIYDKEEYAKAMAWTEKYCKKNE
GNDFNIPEKTKTRAQKDEDWEFIVKMTIIMRDLMQGNPKLKELGFKEEALGHNAIAAGFQ
GQRQWTDFYPNGDFSEALLNTSFDWNGIREAFVVTTENDACNGVAMLFGHLLTNRAQIFS
DVRTYWSPEAVKRVTGKELTGMAANGIIHLINSGATTLDGTGQQTNANGEPAMKPCWEIT
EGEVEKCLEATTWYPANRDYFRGGGFSSNFLSKGGMPVTMMRLNLIKGLGPVLQIAEGWT
VEIDPEIHKLLDERTDRTWPTTWFVPRLCDKPAFKDVYSVMNNWGANHGAISYGHIGQDV
ITLASMLRIPVCMHNVEEDQIFRPAAWNAFGMDKEGADYRACTTYGPIYK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtatccaaaaatcgggattcgtcccaccatcgatggacgtcagggcggcgtt
cgcgaaagccttgaagaaaaaacaatgaatctggcaaaagctgttgccgagttgatcact
tctaatttgaagaatggagacggaacccctgtggagtgtgtgattgcagatggaaccatc
ggacgtgtggctgaaagtgctgcttgtgcggagaagtttgaacgtgagggggtaggagcc
actatcactgtcacttcatgctggtgttacggtgccgaaacaatggatatgaatccgtat
tatccgaaagctgtttggggatttaatggaacagagcgtccgggagctgtatatctggct
gctgtgctggcaggacatgcacagaaaggacttccggcatttggcatttatggtcgcgat
gtacaagacttgaatgacaattctattccggcagatgtagctgaaaaaattctgcgtttt
gcacgtgcggctcaggctgtagccacaatgcgtggcaaatcttatctgtctatgggcagt
gtttctatgggtattgccggttcgattgtaaacccggactttttccaggaatatctgggc
atgcgtaatgaatcgattgatttgacagagattattcgtcgtatggccgaaggaatctat
gataaggaagagtatgccaaggcaatggcttggactgaaaaatattgcaaaaagaatgag
ggcaatgactttaatatacctgaaaaaacgaagacccgtgcacaaaaagatgaggactgg
gagttcattgtgaaaatgacaatcatcatgcgcgatctgatgcagggaaaccctaaattg
aaagaactcggatttaaggaagaggctttggggcataatgctattgcggcaggtttccaa
gggcagcgtcagtggaccgatttctatccgaatggcgacttctctgaagcattactcaat
acttcgttcgattggaatggtattcgtgaggcttttgtcgttacaacagaaaacgatgct
tgtaacggtgtggctatgctgtttggtcatctgctgacgaatcgtgcacagattttttca
gatgtacgcacatattggagtccggaagcagtgaaacgtgtgaccggtaaagagttgaca
ggaatggctgctaacggtattattcacttgattaattcgggggcaactactcttgacgga
accggacagcagacgaatgctaacggagaacctgcgatgaaaccttgctgggaaattaca
gaaggagaagttgagaagtgtctggaggctactacctggtatccggctaatcgcgattat
ttccgtggaggtggtttctcttccaatttcttatcaaaaggaggtatgcctgtaactatg
atgcggttgaacctgataaaaggtcttggtccagtgctgcagatagccgaaggctggaca
gtagagattgatccggagattcataaattacttgacgaacgtacggatcgtacatggcct
actacctggtttgttcctcgtttgtgtgataaaccggcctttaaagatgtatattctgtg
atgaataactggggggccaatcatggggcgatcagttatggacatattgggcaggatgtg
attacattggcttccatgcttcgtattccggtttgcatgcataatgtagaagaagaccag
attttccgtccggcagcttggaatgcttttggtatggataaagaaggagcagattataga
gcttgtactacttatgggcctatttataaataa

DBGET integrated database retrieval system