KEGG   Bacteroides fragilis NCTC9343: BF0233Help
Entry
BF0233            CDS       T00239                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BF0233
  Lipid metabolism
   00561 Glycerolipid metabolism
    BF0233
   00600 Sphingolipid metabolism
    BF0233
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BF0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(256048..258207)
Genome map
AA seq 719 aa AA seqDB search
MKKLLATLLILVACIHVNAQESRQIRISTDRTDLILEVAPDGRLYQSYLGDRLLNEQDLK
NLSGSSRGWEVYPGSGGEDYFEPAVAITNNDGNLSTILRYVSSEQKAVEGGTETIIRMKD
DQYPVDVTLHYVAYPKQNVIKTWSEIKHQQKKPVVLWRYASTMLYFSNQKYYLTEFSSDW
AKEVQMSTQQLQPGKKILDTKLGSRAAMHMQPFFELGLEQPAQEHQGQVVLGTIGWTGNY
QFTFEVDNEGNLRIIPAINPYASDYQLKANETFTTPEFIFTLSNNGTGEASRNLHNWARN
YQLKDGKGDRMTLLNNWENTYFTFDEELLGKLMKEAKHLGVDMFLLDDGWFGNKHPRNDD
HAGLGDWEAMKSKLPGGIPALVEKAKEAGVKFGIWIEPEMVNPKSDLFETHPEWAIHYPN
RETYYFRNQLVLDLSNPKVQDFVFGVVDKIMTENPDVAFFKWDCNSPITNIYSPYLKDKQ
GQLYVDHVRGIYNVLKRVKEKYPNVPMMLCSGGGARCDYEALKYFTEFWCSDNTDPVERL
FIQWGFSQFFPAKAMCAHVTSWNSKTSVKFRTDVASMCKLGFDIGLKDMKADELTYCQEV
VANYKRLKPVILDGDQYRLVSPYDGNHMAVMYTAPDASKAVLFTYDIHPRFGEKLLPVKL
RGLDAQKMYRVKEINLMPGRKSNLSGNEKIFSGDYLMKIGLNAFTTSQTNSRVIELVAE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattacttgcaacattactgattcttgtagcttgtattcatgtcaatgcacaa
gagtccagacagattcgcatctcgacagatcggacggaccttatcctggaagttgctccg
gacggacgtctgtatcaatcttatctgggtgacagactactgaacgaacaagacctgaaa
aacctttccggctcctcacgaggatgggaagtctatccgggttcgggtggagaagattat
ttcgaaccggctgtagccattacgaacaacgatggcaatctcagcacgatcctgcgttat
gtatcttcggaacagaaagcagtggaaggtggaacagaaaccatcatccggatgaaagat
gaccaatatccggtggacgtcacactgcactatgtagcctatcctaaacaaaatgtcatc
aaaacatggagcgagatcaagcatcaacaaaagaagccggtcgtgttatggcgttatgct
tcgacaatgctttacttctcaaaccaaaaatattatctcaccgaattcagcagtgactgg
gctaaagaggtgcagatgagtacacagcaattgcaacccggcaaaaagattctcgatacg
aagttaggtagccgtgctgccatgcacatgcaacctttttttgaactcggactggaacag
cccgctcaggagcatcagggacaagtagtattgggcaccatcggatggacaggcaactac
caatttactttcgaagtggacaatgaaggcaacttacgaatcatccctgctatcaatcca
tacgcctcggactatcaattgaaagcaaacgaaacatttaccaccccggagtttatcttt
acgttgagtaacaacggtacgggtgaagccagccgtaacctgcacaattgggcacgcaac
taccaactgaaagacggcaagggagaccgaatgactctgcttaataattgggaaaatact
tacttcacctttgatgaagaattactgggcaaactgatgaaagaggccaaacacctgggc
gtagatatgttcctgctcgacgacggatggtttggcaacaaacatccgcgcaacgatgac
catgccggcctgggcgattgggaagcgatgaaaagtaagcttcccggaggaatccctgca
ttagtagagaaagcgaaagaagccggtgtcaaattcggtatctggattgaaccggagatg
gtgaatcccaagagtgacctgttcgaaacacatccggaatgggctatccattacccgaac
cgggaaacttattatttccgtaatcagttggtacttgacctgagcaatcctaaagtacaa
gacttcgtgtttggtgtcgtagataagattatgacagagaatcccgatgtagccttcttt
aaatgggattgcaacagtccgattactaatatttattcgccttacctgaaagataaacaa
ggacagctctacgtcgaccacgtgcgcggtatatataatgtattgaaacgggtaaaagag
aaatatcctaatgtgcccatgatgctttgctccggtggaggtgcacgttgtgattatgaa
gcactgaagtacttcaccgaattttggtgttcggataataccgatccggtagaacgctta
ttcattcagtggggcttctcacagttcttcccggccaaagcgatgtgtgcacacgtaaca
agctggaacagcaaaacaagtgtgaaattccgcaccgatgttgccagtatgtgtaaactc
ggtttcgacatcggactgaaagacatgaaagcagatgaacttacttattgccaggaagta
gtagccaattataaacgcttgaaacctgtcattctagatggtgatcaatatcgtctcgta
tctccatatgatggcaaccacatggcagtgatgtatactgcccccgatgcttcgaaagcc
gtcctctttacctacgacatccatccgcgtttcggcgagaaactactaccggtaaagctc
cgggggcttgatgcccaaaagatgtaccgggtgaaggaaattaatctgatgccgggtcgg
aaatccaatttgtcgggtaatgaaaaaatcttctccggtgactatctgatgaaaatagga
ttgaatgcatttacaacttcacaaaccaatagccgggtaatagagttggtagcagagtaa

DBGET integrated database retrieval system