KEGG   Bacteroides fragilis NCTC9343: BF0394Help
Entry
BF0394            CDS       T00239                                 

Gene name
glsA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bfs00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bfs00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bfs00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
482716..483681
Genome map
AA seq 321 aa AA seqDB search
MDKKISISQIKEVVQQAYEQVKGNTGGKNADYIPYLANIDKNLFGISVCLLNGQTITVGD
FDYRFGIESVSKVHTAILILRQYGAQKVLEMIGADATGLPFNSIIAILLENDHPSTPLVN
AGAISACSMVTPIGNSDKKWDAIVQNITDLCGSAPQLIEELYKSETATNFNNRSIAWLLK
NYNRIYDDPNMSLDLYTRQCSLGVTAQMLSVAAGTVANGGVNPVTKKQVFDAELTPKITS
MIATVGFYEHSGDWMYTSGIPAKTGVGGGVMGVLPGVFGVSAFAPPLDGSGNSVKAQLAI
KYIMNKLGLNVFNGARVTIVD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaaatatctatttcccaaataaaagaggttgtgcagcaggcctacgaacag
gtaaaaggtaatacaggcggtaagaatgccgattatattccttatctggccaatatagac
aaaaacctttttggtatcagtgtctgcctgctgaacggtcagaccattaccgtgggtgac
tttgattatcgtttcggtattgaatccgtatctaaagtgcatacagccattctgattctc
cgccaatacggggcacagaaagtgcttgagatgatcggtgcggatgctaccggacttcct
tttaactctatcattgccatcttgttggagaatgaccatccgtctactccgttggtaaat
gccggagccatctcggcttgttccatggtgactccgattggtaattcagataagaaatgg
gacgctatcgtacagaacattaccgatctttgcggttctgctccacagttgatcgaagaa
ctctataagtcggagacagctaccaatttcaataaccgttctattgcctggttactgaag
aactataatcgtatctatgacgatcccaatatgtcactggacctttatactcgccagtgc
tctttgggggtaactgcacagatgttgtcggtggctgccggtacggttgccaatggcggt
gtgaatcctgtgactaaaaagcaggtgttcgatgccgaactgactcctaaaatcacatct
atgattgctaccgtaggcttctacgaacattcgggcgactggatgtatacttcaggtatt
cctgccaagaccggtgtaggtggtggtgtgatgggagtattgccgggtgtattcggtgta
tctgcctttgctcctcctttggatggctcgggcaactcggtgaaagcacagttggccatt
aagtacatcatgaacaaattgggattgaatgtattcaatggtgcgagagtgaccatcgtc
gattag

DBGET integrated database retrieval system