KEGG   Bacteroides fragilis NCTC9343: BF0512Help
Entry
BF0512            CDS       T00239                                 

Definition
ROK family transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF0512
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF0512
   00052 Galactose metabolism
    BF0512
   00500 Starch and sucrose metabolism
    BF0512
   00520 Amino sugar and nucleotide sugar metabolism
    BF0512
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BF0512
   00524 Butirosin and neomycin biosynthesis
    BF0512
Enzymes [BR:bfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BF0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
592862..593842
Genome map
AA seq 326 aa AA seqDB search
MNSSMEKPYVVGIDIGGTNTVFGIVDARGTIIASGAVKTQVYPTVEEYADEVCKNLLPLI
IANGGVDKIKGIGIGAPNGNYYTGTIEFAPNLPWKGVLPLASMFEERLGIPTALTNDANA
AAVGEMTYGAARGMKDFIMITLGTGVGSGIVINGQVVYGHDGFAGELGHVIVRRDGRICG
CGRKGCLETYCSATGVARTAREFLAARTDASLLRNIPAESIVSKDVYDAAVQGDKLAQEI
FEFTGNILGEALADAIAFSSPEAIILFGGLAKSGDYIMKPIMKAMENNLLNIYKGKAKLL
VSELKDSDAAVLGASALAWELKDLRD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaagcatggagaagccctatgtggtgggtattgacattggcggaacaaacact
gtctttggaattgttgacgcgcgcggaactattatagcaagcggtgcagtgaaaactcaa
gtatatcctacagtagaagaatatgcagatgaagtatgcaaaaatcttctgccgttgatt
atcgcaaatggcggggtggataaaataaagggtatcggcattggcgctcctaatgggaac
tattataccggaaccattgaatttgctcctaacttgccttggaaaggtgtattgccgttg
gcttctatgttcgaagaacgcttgggtataccgactgccttgacaaacgatgctaatgct
gccgcagtgggcgaaatgacttacggagccgcccgcggtatgaaagattttatcatgatt
actctgggaacaggtgtcggtagtggtatcgttatcaacggacaggtggtttacggtcat
gacggttttgcaggcgaactcggtcacgtgattgttcgtcgtgacggacgtatctgtggt
tgcggacgcaagggctgtctggaaacttactgctcggctacaggtgtggcacgcactgca
cgtgaattcctcgctgcacgtaccgatgccagcttgttgcgtaatatcccggctgagagc
attgtatcgaaagacgtatacgatgcagccgtacagggagataaactggctcaggagatt
ttcgaatttacaggtaatattctgggtgaagcattggcagacgctattgctttctcgagt
ccggaagctattatcctgttcggtggtttggcaaaatcgggtgattacattatgaagccg
attatgaaagccatggagaataaccttctgaacatttacaaaggtaaagcaaaattgctc
gtttctgagttgaaggactctgacgctgctgtgctgggtgccagtgcattggcttgggaa
ctgaaagacttgagagactaa

DBGET integrated database retrieval system