KEGG   Bacteroides fragilis NCTC9343: BF0526Help
Entry
BF0526            CDS       T00239                                 

Definition
aspartate kinase (EC:2.7.2.4)
Orthology
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, DAP dehydrogenase pathway, aspartate => lysine
Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:bfs01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfs01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bfs00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bfs00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bfs00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(616591..618009)
Genome map
AA seq 472 aa AA seqDB search
MKRRQIRKKNRITKKNREMKIYKFGKIPTGSVQGMKGMLRLIDNSIPKIIVLSATTETTE
RLAGIAAHLFNRDTEQAHDEISRLEFRFIDFANELFNDESIKQQAVDSIIDRFRTLWNFT
RQRFTSVDEKDILAQGEFISSMLVSLYLKEQGINNRLLNSLDFMRLAPEEEPDMEYIGTK
LHLLLAEHKSTNVFLTQGHLCRNAYNETCYLKQGGDDVSATLIGAALQAQEVCLWTDSKE
LHSCDPRFVKHPAMVKQLSFDEAEQLAYCGWTGFNPHCILPARENNIPIRLLCSMEPAEG
GTLISNSQSGENIKAITARDNIYYIKFQSNRTLRPYLFISKIFDTFAKYHTSLCLFASSG
SDVSVAINDKERLSHILHELSRYAATVVKDHMCILSAIGNMQWQCAGFEARIINALATIP
IRMISYGSNNNNVSLVIRAEDKREALQRLNDTLFAPCHANPSQIHVPTLKHS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggagacagataagaaaaaagaatcgtataactaaaaaaaatagagaaatgaaa
atctacaaattcggtaagattcccacaggctcagtacagggaatgaaaggaatgctccgc
ctgattgacaacagtatccccaaaataatcgttctgtccgccactacagagactacggaa
cgtctggccggaatagctgcccatcttttcaacagagatacagaacaggcgcatgacgag
ataagcaggcttgaattcaggtttatcgatttcgccaacgaactattcaatgacgaatcg
atcaagcaacaggcggtcgattccatcatcgatcgtttccggactctatggaactttacc
cgccaacgttttacatctgtcgacgagaaagacatactggcacagggagaatttatcagc
agtatgctagtcagcctctatctgaaagagcagggaatcaacaaccgactactcaacagc
ctcgacttcatgcgactggctccggaagaagaaccggacatggaatacatcggtacaaag
ctacacttgctcttggcagagcataagtcgaccaatgtatttcttactcaaggacatctt
tgccggaatgcttacaacgaaacctgttacttgaaacaaggcggagatgatgtttcagcc
acactgatcggagctgctcttcaggcacaagaagtatgtctgtggacagacagcaaagag
ttgcacagttgtgacccgcgctttgtgaagcatccggcaatggtgaagcagctcagtttc
gacgaagccgaacaactggcctattgcggctggacgggattcaaccctcactgcatcctg
cccgcaagagaaaacaacataccgatacgtttgctatgttcgatggagcctgcagaagga
ggaactttgatttcaaattcacaaagcggagaaaacataaaggccattaccgccagagac
aatatttattacattaaattccaatcgaaccgaacgttacgcccctatctgttcatcagc
aaaatattcgatacttttgccaaataccacacttccctgtgcctgttcgcctcgtccggt
tctgatgtatctgttgccatcaacgacaaagagcgtttatcgcatatactccacgaactc
tcacgatatgcagccacggtggtaaaagaccacatgtgcatcctttcggccataggtaac
atgcagtggcaatgcgccggatttgaagcccgaatcataaatgctttggccaccatcccg
atccgaatgatctcttatggcagtaataacaacaatgtttcacttgtcatcagggcagaa
gataagagagaggcattgcaacgactgaacgacacgctgttcgctccctgccatgcaaat
ccttctcagatacatgttccgacattaaaacacagttag

DBGET integrated database retrieval system