KEGG   Bacteroides fragilis NCTC9343: BF0560Help
Entry
BF0560            CDS       T00239                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BF0560 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF0560 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BF0560 (thrC)
Enzymes [BR:bfs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BF0560 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
668218..669519
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQAPLASLEEAVVKGLASDKGLFMPMTIKPLPQEFYDEIENLSFREIAYRVAD
AFFGEDVPAETLKEIVYDTLNFDVPLVPVKENIYSLELFHGPTLAFKDVGGRFMARLLGY
FIRKEGRKQVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGRNI
TALEVDGTFDDCQALVKAAFMDQELNEQLLLTSANSINVARFLPQAFYYFYAYAQLKKAG
RAENVVICVPSGNFGNITAGLFGKKMGLPVRRFIAANNKNDIFYQYLQTGQYNPRPSVAT
IANAMDVGDPSNFARVLDLYGGSHAAIAAEISGTTYTDEQIRESVKACWQQTGYLLDPHG
ACGYRALEEGLQPGETGVFLETAHPAKFLQTVESIIGTEVEIPAKLRAFMKGEKKSLPMT
KEFADFKSYLLGK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatagtactaacaaacaagctccgcttgcttcgcttgaagaagcggtagtc
aaaggacttgcttctgataaggggctattcatgcccatgaccatcaagcccttgcctcaa
gagttttatgacgagatagagaatctttctttccgggaaatcgcttaccgggtggcagat
gctttctttggagaagatgttccggcggaaacgctgaaagagatcgtttatgatacgttg
aattttgatgtcccgttggtgccggtgaaggagaacatctattccctggagcttttccac
ggtcctacattggcttttaaagatgtaggtggacggtttatggcccgtttgttgggatac
ttcatccggaaagaggggcggaaacaggtgaatgtgctcgttgccacttccggagatacc
ggtagtgcggtagccaatggctttttgggggtagagggtattcatgtgtatgtgctctat
ccgaagggaaaagtcagcgagatacaggaaaaacagttcactacgctggggcggaatatt
acagccctggaggtggacggaacgtttgatgactgccaggcgctggtgaaagcagccttt
atggatcaggaactgaacgaacagttgttgctgacctcggctaactctatcaacgtggca
cgtttcctgccgcaggcattctattatttttatgcctatgcgcaattgaagaaggccggc
cgggcagagaatgtcgtcatctgtgtgccgagcggaaactttggtaacattactgcaggc
ttgttcggcaaaaagatgggcttgcccgtccgccgttttatcgccgccaacaataagaat
gatattttctatcaatatttgcagacaggacagtacaatccccgtccgtccgttgccacc
attgccaatgcgatggatgtgggtgatccgagcaactttgcccgtgtgctcgacctgtat
ggcggttcgcatgcagccatcgctgccgagatatccggaacgacgtacaccgacgagcag
attcgtgaaagcgtgaaagcgtgctggcagcagacgggttatctgctcgatcctcatgga
gcatgcggttaccgtgcattggaggaaggcttgcagccgggtgagacaggcgtattcctc
gaaacggcccatccggccaaattcctgcaaacggtggagagcatcattggtaccgaggtc
gaaatacctgctaagctccgggcttttatgaaaggcgaaaagaaaagtttgccgatgacg
aaggagtttgctgatttcaagagctatctgctgggcaagtag

DBGET integrated database retrieval system