KEGG   Bacteroides fragilis NCTC9343: BF0560Help
Entry
BF0560            CDS       T00239                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfs01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bfs00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bfs00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
668218..669519
Genome map
AA seq 433 aa AA seqDB search
MKYYSTNKQAPLASLEEAVVKGLASDKGLFMPMTIKPLPQEFYDEIENLSFREIAYRVAD
AFFGEDVPAETLKEIVYDTLNFDVPLVPVKENIYSLELFHGPTLAFKDVGGRFMARLLGY
FIRKEGRKQVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGRNI
TALEVDGTFDDCQALVKAAFMDQELNEQLLLTSANSINVARFLPQAFYYFYAYAQLKKAG
RAENVVICVPSGNFGNITAGLFGKKMGLPVRRFIAANNKNDIFYQYLQTGQYNPRPSVAT
IANAMDVGDPSNFARVLDLYGGSHAAIAAEISGTTYTDEQIRESVKACWQQTGYLLDPHG
ACGYRALEEGLQPGETGVFLETAHPAKFLQTVESIIGTEVEIPAKLRAFMKGEKKSLPMT
KEFADFKSYLLGK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatagtactaacaaacaagctccgcttgcttcgcttgaagaagcggtagtc
aaaggacttgcttctgataaggggctattcatgcccatgaccatcaagcccttgcctcaa
gagttttatgacgagatagagaatctttctttccgggaaatcgcttaccgggtggcagat
gctttctttggagaagatgttccggcggaaacgctgaaagagatcgtttatgatacgttg
aattttgatgtcccgttggtgccggtgaaggagaacatctattccctggagcttttccac
ggtcctacattggcttttaaagatgtaggtggacggtttatggcccgtttgttgggatac
ttcatccggaaagaggggcggaaacaggtgaatgtgctcgttgccacttccggagatacc
ggtagtgcggtagccaatggctttttgggggtagagggtattcatgtgtatgtgctctat
ccgaagggaaaagtcagcgagatacaggaaaaacagttcactacgctggggcggaatatt
acagccctggaggtggacggaacgtttgatgactgccaggcgctggtgaaagcagccttt
atggatcaggaactgaacgaacagttgttgctgacctcggctaactctatcaacgtggca
cgtttcctgccgcaggcattctattatttttatgcctatgcgcaattgaagaaggccggc
cgggcagagaatgtcgtcatctgtgtgccgagcggaaactttggtaacattactgcaggc
ttgttcggcaaaaagatgggcttgcccgtccgccgttttatcgccgccaacaataagaat
gatattttctatcaatatttgcagacaggacagtacaatccccgtccgtccgttgccacc
attgccaatgcgatggatgtgggtgatccgagcaactttgcccgtgtgctcgacctgtat
ggcggttcgcatgcagccatcgctgccgagatatccggaacgacgtacaccgacgagcag
attcgtgaaagcgtgaaagcgtgctggcagcagacgggttatctgctcgatcctcatgga
gcatgcggttaccgtgcattggaggaaggcttgcagccgggtgagacaggcgtattcctc
gaaacggcccatccggccaaattcctgcaaacggtggagagcatcattggtaccgaggtc
gaaatacctgctaagctccgggcttttatgaaaggcgaaaagaaaagtttgccgatgacg
aaggagtttgctgatttcaagagctatctgctgggcaagtag

DBGET integrated database retrieval system