KEGG   Bacteroides fragilis NCTC9343: BF1057Help
Entry
BF1057            CDS       T00239                                 

Definition
restriction enzyme of type III restriction-modification system
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bfs  Bacteroides fragilis NCTC9343
Brite
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     BF1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1311846..1314878)
Genome map
AA seq 1010 aa AA seqDB search
MKLKFKHQKFQEDAAKAVCDVFGGQPYKTFDYQVETRKKDGQTSFEKFTGFRNHPIVPQL
TDEIVLKHIRDIQRAQQIKPSEALEGKYNLTIEMETGVGKTYTYIKTIFELNKRYGWCKF
IIVVPSVAIREGVHKSLEIMKEHFASDYSTPLSYFIYDSKQLGELNAFVTDSKIHVMIIN
SQKFNATNKDARRIYMKLDDFGGNCPIDVIAQMNPILIIDEPQSVEGVKTKEGLKRFNPL
FTLRYSATHRELYNLVYRLDAMEAYNLQLVKKIAVKGISISGTTATEGFVYLEGLNLYPD
KNPTANIGFEVKRTKAVNQVVRALKINDDLYAKSNHLEEYRNDYVITDINGVEDSVTFRN
GIKLYAGDVAGSVNETQLRRIQIRETILSHIEKEQELFEKDIKVLSLFFIDEVAKYRRYN
PDGKGEYAEIFEQEYTDIIKHLDLSLFNQPEYIDYLKSTVASKAHEGYFSKDKKGKLIDS
KTERGTKESADEDAYDLIMKNKERLLDRKEPIRFIFSHSALREGWDNPNVFQICTLKQSS
AEVRKRQEVGRGLRLCVNGQGDRMDANVLGEEVHRVNLLTVIASESYESFAKGLQTEMAE
AIADRPQKVTIQLFKDQSLRLANGETIIATEDIAQSIYDSLLENKYIKKGELTDKFYEDR
KQGEVIFDDELTDYKASIMTILASIYNPREMQPNDARKSKINLRLSKDKLENSKLQELLK
LLCSKSTYTVKFDEKELVERAIESLNEKLRVSQLYLSVITGQMEKIKSKAALISGEAFKV
DANQAHYEKIDAMANDQVKYDLLGKLTDATNLTRQAVAQILSRIKPNVFGQFKNNPEDFI
IKASELINEEKACLIVKHIEYTPIDQYYDVSVFTRATIQGRLGVNTIKADKHLYDHVRFD
SQNEKTFMERLEENDEIEAYVKLPGNFYIPTPMGKYHPDWAIVFKQKLSKYPYFIAETKA
SDSSLQDRRIEEAKIECAKKHFAKTNGGKLKYNKVSSFEDLLKIVTQESV
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaattcaaacatcagaagtttcaggaagacgcagcaaaagcggtatgtgat
gtctttggcgggcagccatacaagacgttcgactatcaagtagagacccggaagaaagac
ggacagaccagctttgaaaagtttacaggattccgtaaccaccctatcgtacctcaactc
acagatgagatcgttctgaaacacatccgggatatccagcgtgcccaacaaatcaaaccg
tcggaagcgctggaagggaaatacaatctcaccatcgaaatggagacgggtgtaggtaaa
acgtatacctacatcaaaaccatctttgaactgaacaaacgctacggttggtgcaagttc
atcattgtcgtacccagtgttgccatccgcgaaggagtccacaaaagcctggagattatg
aaggaacactttgcctcggattacagcacccctctgtcttatttcatctacgactccaaa
cagttgggtgaattgaacgcatttgtcacagacagcaaaatccatgtaatgatcatcaat
tcacagaagttcaatgcaacgaacaaagatgcccgccgcatctacatgaagctggatgat
tttggcggaaactgtcccatcgatgtgattgcgcagatgaatccgatactgattatcgac
gaacctcagtcagtagaaggagtcaaaacaaaagagggattgaaacgattcaatcccctg
ttcacactgcgttattcggctacacaccgcgaactctataatctggtctatcgcctggac
gcaatggaagcttacaacctgcaactggttaagaagatcgctgtcaagggtatctctatc
agtgggacaacagctactgaaggattcgtttatctggaaggtttgaacctgtatccggac
aaaaacccgactgccaatatcggattcgaagtaaaaagaaccaaagcagtgaatcaggta
gtacgagctctgaagataaatgatgacttgtatgctaaatcaaaccatctggaagaatac
cggaacgactatgtaattacagatatcaacggcgttgaagactccgtcaccttccggaac
ggcatcaaactttatgcaggtgacgtagcgggtagcgtcaacgaaacccaactacgacgt
atccagatacgggaaaccatcttgtcacacatagaaaaagaacaggaactgtttgagaaa
gacatcaaagttctctcccttttcttcatcgatgaagtagccaaataccgccggtataac
ccggacggaaagggagaatatgccgagattttcgaacaggaatataccgatatcataaaa
cacctggatctttcgttattcaatcagccggaatatatcgattacctgaaatcgactgtg
gcatcgaaagctcacgaaggatacttctccaaagataaaaaaggaaaactgattgacagt
aaaaccgagcggggaaccaaagaatcggcagatgaagatgcttacgatttgattatgaag
aataaagaacgtctgcttgaccggaaagagccgatccgctttattttctcacattccgct
ctgcgggaaggatgggacaacccgaatgtctttcagatctgtaccctgaaacaaagttcg
gcagaggtacgcaagcgtcaggaagtgggacgagggctgcgcctctgtgtaaacggacag
ggagatcgcatggacgccaacgttttaggcgaagaagtgcatcgtgtcaacctactgacc
gtgatagccagcgaatcgtacgaatcgtttgccaaaggcttacagacagaaatggcggaa
gccatagccgaccgtccacagaaagtaaccatccaattattcaaggaccagtcgctccga
ttagctaacggtgaaaccatcatagccaccgaagatatagcacaaagtatctacgactct
ttacttgaaaacaagtacatcaagaaaggagaactgacagacaaattctatgaagatcgt
aaacagggagaagtgattttcgacgacgagctcaccgattataaggcgtctatcatgacc
atcctggcctctatctataatccaagggagatgcagccgaacgatgcaaggaaaagtaag
ataaatcttcggttgtcgaaagataaacttgaaaacagcaaacttcaggaactgttaaag
ctgctatgcagtaagtcaacctacaccgtaaagtttgacgaaaaagaattggtagagaga
gcgatcgaaagtttaaatgaaaagttaagagtatcccagctctatctttctgtcattacg
ggccaaatggaaaaaatcaagtccaaagcagctttaatttcgggagaggcatttaaggta
gatgccaatcaggcgcactatgaaaagatagatgccatggcaaacgatcaagtaaaatat
gacttactcggtaaactcacagacgccaccaatctgacccgacaggcagttgctcagatt
ctctcccggataaaaccgaatgtattcggccaattcaaaaacaatcccgaggattttatt
atcaaggcttcggaactgattaacgaagaaaaagcatgtctgatagtaaaacatatcgaa
tataccccaatcgaccagtactatgatgtatcggtctttacccgggcaactattcaggga
cgtttgggagtaaacacaataaaagcagataaacatctgtacgatcatgtgagattcgac
tcccaaaatgaaaaaacattcatggaaagactggaagaaaacgacgaaatagaagcttat
gtaaaactacccggcaatttctatatccctactccgatgggaaaataccatccggactgg
gccatcgtcttcaaacaaaagttatcgaagtatccttattttattgccgaaaccaaagcc
agcgattcctccctacaagatcggagaatagaagaggcaaagatcgaatgtgccaaaaaa
cattttgcgaagacaaacggtgggaagcttaaatataataaagtaagctccttcgaagat
ctcttgaaaatcgtcacacaagaatccgtttaa

DBGET integrated database retrieval system