KEGG   Bacteroides fragilis NCTC9343: BF1418Help
Entry
BF1418            CDS       T00239                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BF1418
  Lipid metabolism
   00561 Glycerolipid metabolism
    BF1418
   00600 Sphingolipid metabolism
    BF1418
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BF1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
1685474..1686976
Genome map
AA seq 500 aa AA seqDB search
MNKPYFIAFLLFLALWTAIPSVFAGDVVLKVFEGKPRINSPHIIGNYPSTPFIFYIPTSG
QRPMQWSAEKLPEGLELDSKTGIISGVMTSKGDYTVTLKAENALGVSVKQLVIRIGDELL
LTPPMGWNSWNTFGQHLTEELVLQTADAMITNGMRDLGYSYINIDDFWQLPERGADGHLQ
IDKTKFPRGIKYVADYLHERGFKLGIYSDAAEKTCGGVCGSYGYEETDAKDFASWGVDLL
KYDYCNAPVDRVEAMERYAKMGRALRATNRSIVYSVCEWGQREPWKWAKQVGGHLWRVSG
DIGDIWYRDGNRVGGLHGILNILEINAPLSEYAGPSGWNDPDMLVVGIDGKSMSIGYESE
GCTQEQYKSHFSLWCMMASPLLSGNDVRNMNDSTLKILLDPDLIAINQDVLGRQAERSIR
SDHYDIWVKPLADGRKAVACFNRASSPQTVILNENTIADLSFEQIYCLDNHLTKSGSDSK
ELIVKLAPYQCKVYIFGKTD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaccctatttcattgcatttttactctttttagctttatggacagccattcct
tctgtttttgccggagatgttgttttaaaagtatttgaagggaaaccacgtatcaattct
cctcatatcataggtaattatccttcaactccatttatcttttatattccgacttccggt
cagcgaccgatgcagtggagtgcggaaaaactccccgaaggactggaactggattccaag
actggcattattagtggagtcatgacttccaaaggagattataccgtaaccctgaaggct
gagaatgcattaggtgtaagtgtgaaacaattggtcatccgcattggtgatgaattatta
ttaactcctccaatgggctggaacagttggaatactttcggacagcatctgacagaagaa
ttggtcttgcaaacggcggatgcgatgataacgaacggaatgcgtgatttaggatattcc
tatatcaatatagatgacttttggcagttgccggaacggggggctgacggacatctgcag
attgataaaactaagtttccacgtgggataaaatatgtagctgattatctgcacgagcgt
gggtttaaattgggaatttattcggatgccgccgaaaaaacttgtggcggcgtttgcggt
agctacggatatgaagaaacagatgcaaaagattttgcctcttggggagttgacttgttg
aaatatgactattgcaatgctcctgtagatagggtagaagccatggagcgatatgcgaaa
atgggaagggcactacgggctaccaatcgttcgattgtctattcagtgtgtgagtgggga
cagcgtgaaccttggaaatgggcgaagcaagtggggggacatttatggagagtatcagga
gatatcggtgacatttggtatcgggatggaaatcgtgttggtggattacatggtatattg
aatatccttgaaatcaatgctcctctgagtgaatatgccggtccatccggttggaatgat
ccggatatgttagtggtcggaatagatggaaagagtatgagtattggttatgagtcggaa
ggatgtactcaggaacaatataaatcccattttagcctgtggtgtatgatggcttctcct
ttactttccggaaacgatgtacggaatatgaatgatagtacattaaaaatcttgttggat
cctgatttaatagccattaatcaggatgtgttaggtaggcaggcagaacgcagcattcgt
tcggatcattatgatatttgggtaaagccgttggcagatggacgtaaagctgtggcttgc
tttaaccgggcaagctctccgcaaactgtgatattgaatgaaaatacgattgccgattta
tcattcgagcagatatactgtttggacaaccatttgacaaagagtggtagtgattcaaag
gaactgatagtaaaactggccccatatcaatgtaaggtctatattttcggtaaaacggat
tga

DBGET integrated database retrieval system