KEGG   Bacteroides fragilis NCTC9343: BF1635Help
Entry
BF1635            CDS       T00239                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF1635
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BF1635
  Amino acid metabolism
   00310 Lysine degradation
    BF1635
Enzymes [BR:bfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BF1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1907410..1908777
Genome map
AA seq 455 aa AA seqDB search
MARFEIKMPKLGESITEGTILSWSVQVGDVVNEDDVLFEVNTAKVSAEIPSPVAGKVVEI
LFKEGDTVPVGTVVAIVDMDGEGSGEASETAGSVETASAPKAAEVSDTASVPKVQAEVAA
PKVERWYSPAVLQLAREAKISQEELDSIPGTGYEGRLSKKDIRTYIEMKKGAPAADVSTT
VVSTVLANNSGSSPVPSAEVQKKAAAAAPQAQHGQSASAVSSDASVEVKEMDRVRRIIAD
HMVMSKKVSPHVTNVVEVDVTRLVRWREKTKDAFFRREGVKLTYMPAIAEATAQALAAYP
QVNVSVDGYNILYKKHINVGIAVSQDDGNLIVPVVHDADRLNLNGLAVAIDSLAKKARVN
KLMPDDIDGGTFTITNFGTFKMLFGTPIINQPQVAILGVGVIEKKPAVVETPEGDVIAIR
HKMYLSLSYDHRVVDGSLGGNFLHFIADYLENWKE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcaagattcgaaataaaaatgcccaagttgggcgaaagtattaccgaaggaaccatt
ttatcatggtcggtgcaggtaggtgacgtggtcaatgaggacgacgtacttttcgaggtg
aatactgctaaggtcagtgcggagatcccttctcccgttgccggaaaagtggtggaaata
ttgtttaaagaaggcgatacggtaccggtaggtacggtagttgccattgtagatatggat
ggagaaggttccggagaagcatcggaaaccgcaggctctgtagaaacggcgtctgctcca
aaggctgccgaggtgtcggacactgcgtctgttccgaaagttcaggcggaagtagccgct
cccaaagtggaacgttggtattcgccggcagtacttcaattggcacgggaggcgaagatt
tctcaggaagaactggattcgattcccgggacaggttatgaaggccggctgagcaaaaaa
gatatccgcacttacatcgagatgaagaaaggtgctccggcagccgacgtctctactacg
gtggtttcgacggttttggcaaataattcgggctcttctcctgttccttctgcagaagta
caaaagaaggctgccgctgcggctcctcaggctcagcatggacaatctgcttctgccgtt
tcttcagatgcatcggtagaagtcaaggagatggatcgagtacgtcgcatcattgccgac
catatggtgatgtcgaaaaaggtttctccgcatgtgactaatgtggtcgaagtagatgtc
acccggctggtgcgttggcgcgaaaagaccaaagatgctttcttccgtcgtgaaggtgtg
aagctgacttatatgcctgccattgctgaggccactgcccaggcgttggctgcctatcct
caggtaaatgtctcggtggacggatacaacatcctgtataagaaacatatcaatgtgggc
attgctgtttcgcaagatgatggaaacttgattgttcccgtagtgcatgatgccgatcgt
ttgaatcttaacggacttgccgtagctatcgattcgttggcgaaaaaggcacgggttaat
aagctgatgcctgatgatatcgacggaggaacatttacaatcaccaatttcggtacgttt
aagatgttgttcggaactccgatcatcaatcagccgcaggtggctattctcggagtgggt
gtcattgagaaaaagccggctgtggtggagactcccgaaggagatgtgatagccattcgc
cataagatgtacttgtcactctcttatgatcaccgtgtggtggatggttcgctgggaggt
aacttcctgcacttcattgccgattatctggagaactggaaagaatag

DBGET integrated database retrieval system