KEGG   Bacteroides fragilis NCTC9343: BF1635Help
Entry
BF1635            CDS       T00239                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BF1635
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BF1635
  Amino acid metabolism
   00310 Lysine degradation
    BF1635
Enzymes [BR:bfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BF1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1907410..1908777
Genome map
AA seq 455 aa AA seqDB search
MARFEIKMPKLGESITEGTILSWSVQVGDVVNEDDVLFEVNTAKVSAEIPSPVAGKVVEI
LFKEGDTVPVGTVVAIVDMDGEGSGEASETAGSVETASAPKAAEVSDTASVPKVQAEVAA
PKVERWYSPAVLQLAREAKISQEELDSIPGTGYEGRLSKKDIRTYIEMKKGAPAADVSTT
VVSTVLANNSGSSPVPSAEVQKKAAAAAPQAQHGQSASAVSSDASVEVKEMDRVRRIIAD
HMVMSKKVSPHVTNVVEVDVTRLVRWREKTKDAFFRREGVKLTYMPAIAEATAQALAAYP
QVNVSVDGYNILYKKHINVGIAVSQDDGNLIVPVVHDADRLNLNGLAVAIDSLAKKARVN
KLMPDDIDGGTFTITNFGTFKMLFGTPIINQPQVAILGVGVIEKKPAVVETPEGDVIAIR
HKMYLSLSYDHRVVDGSLGGNFLHFIADYLENWKE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcaagattcgaaataaaaatgcccaagttgggcgaaagtattaccgaaggaaccatt
ttatcatggtcggtgcaggtaggtgacgtggtcaatgaggacgacgtacttttcgaggtg
aatactgctaaggtcagtgcggagatcccttctcccgttgccggaaaagtggtggaaata
ttgtttaaagaaggcgatacggtaccggtaggtacggtagttgccattgtagatatggat
ggagaaggttccggagaagcatcggaaaccgcaggctctgtagaaacggcgtctgctcca
aaggctgccgaggtgtcggacactgcgtctgttccgaaagttcaggcggaagtagccgct
cccaaagtggaacgttggtattcgccggcagtacttcaattggcacgggaggcgaagatt
tctcaggaagaactggattcgattcccgggacaggttatgaaggccggctgagcaaaaaa
gatatccgcacttacatcgagatgaagaaaggtgctccggcagccgacgtctctactacg
gtggtttcgacggttttggcaaataattcgggctcttctcctgttccttctgcagaagta
caaaagaaggctgccgctgcggctcctcaggctcagcatggacaatctgcttctgccgtt
tcttcagatgcatcggtagaagtcaaggagatggatcgagtacgtcgcatcattgccgac
catatggtgatgtcgaaaaaggtttctccgcatgtgactaatgtggtcgaagtagatgtc
acccggctggtgcgttggcgcgaaaagaccaaagatgctttcttccgtcgtgaaggtgtg
aagctgacttatatgcctgccattgctgaggccactgcccaggcgttggctgcctatcct
caggtaaatgtctcggtggacggatacaacatcctgtataagaaacatatcaatgtgggc
attgctgtttcgcaagatgatggaaacttgattgttcccgtagtgcatgatgccgatcgt
ttgaatcttaacggacttgccgtagctatcgattcgttggcgaaaaaggcacgggttaat
aagctgatgcctgatgatatcgacggaggaacatttacaatcaccaatttcggtacgttt
aagatgttgttcggaactccgatcatcaatcagccgcaggtggctattctcggagtgggt
gtcattgagaaaaagccggctgtggtggagactcccgaaggagatgtgatagccattcgc
cataagatgtacttgtcactctcttatgatcaccgtgtggtggatggttcgctgggaggt
aacttcctgcacttcattgccgattatctggagaactggaaagaatag

DBGET integrated database retrieval system