KEGG   Bacteroides fragilis NCTC9343: BF1663Help
Entry
BF1663            CDS       T00239                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfs00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfs00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1937012..1938136)
Genome map
AA seq 374 aa AA seqDB search
MQEILIIPDMINTFPTEGNRSGLSRKDFQKDINDKKTDLFILKNKKGMEVAVTNYGCAIL
SIMVPDKDGKYANVVLSYGTLDALMHGPEPFLSTTIGRYGNRIAKGKFTLYGEEHSLTIN
NGPNSLHGGPTGFHARVWDAEQLEEGVIRFNYTSADGEEGFPGNLEVEMTYRLEEEENAI
VIEYRATTDKATVVNLTNHGFFNLAGTANPTPTVENNIVTINADFYTPIDEVSIPTGEIA
KVEGTPMDFRTPHTVGERINDKFQQLIYGAGYDHCYVLNKAETGSLDLAATCKEPNSGRI
MEVYTTEAGVQLYTGNWLGGFEGTNGATFPARSAICFEAQCFPDTPNKAHFPSATLLPGD
EYQQVTIYKFGVEK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagaaattttaataataccagacatgattaacacattcccaactgaaggaaatcgg
tcagggctcagccggaaagattttcaaaaggatataaacgataagaaaaccgatttgttt
atcctcaaaaacaagaaaggaatggaagttgccgtaacaaactacggatgcgccattcta
tctatcatggttccggataaagacggaaaatatgccaatgttgtactcagctatggtaca
ctggatgcactgatgcacggaccggaacctttcttaagtaccactatcggacgttatggc
aatcgcatcgccaaaggtaaattcaccctgtatggcgaagaacatagtctcacgatcaac
aacggtcccaactcacttcatggtggccccaccggatttcacgccagagtatgggatgcc
gagcaacttgaagaaggggtgatccgattcaactatacttccgctgacggagaagagggc
ttccccggtaatctggaagttgaaatgacttatcgccttgaagaagaagagaatgcgatt
gtcatcgaataccgtgccactacagacaaagcaacagtcgtaaacctgaccaatcacggt
ttcttcaacctggcaggaacagccaatcctactccgactgtagaaaataacatcgtcaca
atcaacgcagatttttatactccgatcgatgaagtatccatcccgacaggagaaatagcc
aaagtggaaggaactccgatggatttccgtaccccacatactgttggcgaacgaatcaat
gacaaattccagcaacttatatacggtgccggctatgaccattgctatgtattgaacaag
gcagaaacaggttctctcgacctggcagctacctgcaaagagcccaacagcggacgcatc
atggaggtatataccacagaagccggcgtacaattatacacaggcaactggctgggcggc
ttcgaaggaacaaacggagctactttccccgcacgaagcgctatctgcttcgaagctcaa
tgcttccccgacacaccgaataaagcacacttcccgtcggctactttactgccgggcgat
gaataccagcaggtaaccatctataaattcggagttgaaaaataa

DBGET integrated database retrieval system