KEGG   Bacteroides fragilis NCTC9343: BF1815Help
Entry
BF1815            CDS       T00239                                 

Gene name
bgaA
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BF1815 (bgaA)
  Lipid metabolism
   00600 Sphingolipid metabolism
    BF1815 (bgaA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BF1815 (bgaA)
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BF1815 (bgaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2117168..2119669
Genome map
AA seq 833 aa AA seqDB search
MNKKIKIAFASMLAVPLLACAQVRTEQTFEKGWKFTREDSKDFSNSTYDDAKWQSVTVPH
DWAIYGPFSINNDKQNVAISQDGQKEAMEHAGRTGGLPFVGVGWYRLNFDAPSFSKGKKA
TLVFDGAMSHAHVYINGQEAGYWPYGYNSFYVDATPYLKPGEKNTLAVRLENENESSRWY
PGAGLYRNVHLVVNEDAHIPTWGTQLTTPVVKDEFAKVNLKTKLDVPAGKAFEGYRIVTE
LKDKDGKVVAANEKKGGPFDDNVFEQDFVVTSPALWTPDTPHLYSAVSKVYEGNTLKDEY
TTSFGIRSIEIIPNKGFFLNGKKTMFKGVCNHHDLGPLGGIANDAGIRRQIRILKDMGCN
AIRTSHNMPAPELIKACDEMGMMIMAESFDEWKAAKVQNGYHKVFDEWVEKDLVNLIHQY
RNNPSVVMWCIGNEVPDQWNGDRGPKLSRFLQDICHREDPTRPVTQGMDAPDAVVNNNMA
AVMDVAGFNYRPHKYQENYKKLPQQIILGSETASTVSSRGVYKFPVVRRAMQKYDDHQSS
SYDVEHCGWSNLPEDDFIQHEDLPYCIGEFVWTGFDYLGEPTPYYTDWPSHSSLFGIIDL
AGLPKDRYYLYRSHWNKDKETLHILPHWNWEGREGEVTPVFVYTNYPSAELFINGKSQGK
RTKDLSVTVNNSGDSTSVANFKRQQRYRLMWMDTKYEPGTVKVVAYDKDGKAVAEKEIHT
AGKPDHIELVADRSVIDANGKDLSFVTVKVVDKEGNLCPLADNEISFKVKGAGTYRAGAN
GNPASLESFQTPKMKVFSGMMTAIVQSTEKAGKITLEATGKGLKKGTLLIESK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaaatcaaaattgcatttgcttcgatgctcgctgtgccgctgttggcgtgt
gcgcaagtccgtacggaacaaacctttgagaagggatggaagttcactcgtgaggatagt
aaagactttagtaactctacgtatgatgatgcgaagtggcaatctgtgaccgttccgcat
gattgggctatttacggaccattcagtattaataatgataaacagaacgtagccatttct
caggatggacagaaagaggcgatggagcatgccggacgtaccgggggacttccttttgtc
ggtgtgggatggtataggctcaattttgatgctccttcattcagtaagggcaaaaaggct
actctggttttcgatggagccatgagccacgcacatgtctatatcaacggacaagaggcc
ggttattggccttacggttacaatagtttttatgtggatgccactccttatttgaaaccg
ggtgaaaagaacacattggcggttcggcttgaaaacgagaacgaatcttcacgttggtat
ccgggtgccggattatatcgcaatgtacatctggtagtgaacgaagatgcccatattcct
acttggggtactcagctgactactcctgtagtgaaagatgaatttgcaaaggtaaacctg
aaaaccaaactcgatgtaccagccggaaaagcattcgaaggatatcgtattgttaccgaa
ctgaaggataaggatggtaaagtggtggcagccaacgaaaagaagggaggtccgttcgat
gacaatgttttcgaacaagatttcgtagtgacttctccggctttgtggactccggatact
ccgcatctttatagtgccgtttctaaagtatatgaggggaatactctgaaggatgaatat
actacttcattcggtattcgttccattgagattattccgaataaaggtttcttcctgaat
ggaaagaaaaccatgttcaaaggtgtgtgcaatcaccatgatctcggaccgttgggaggt
attgccaatgatgccggtattcgccgtcagattcgtatcctgaaagacatgggctgcaat
gccatccgtacttcacataatatgcctgctcccgaattgattaaagcttgtgatgaaatg
ggcatgatgataatggccgagtcatttgacgagtggaaagcagccaaagtacagaatggt
tatcacaaagtgtttgatgaatgggtagagaaagatctggtgaatctgattcatcagtat
cgcaataatccgagcgtggttatgtggtgtatcggtaatgaggtgcccgaccagtggaac
ggtgaccgtggaccgaaactgtcacgcttcttgcaggatatctgccatcgtgaagatcct
acacgtcctgttactcagggtatggatgctcccgatgcagtagtcaataataatatggcg
gctgtgatggacgtagccggttttaattaccgtcctcacaaatatcaggaaaactacaaa
aaacttccgcaacagatcatcctgggtagcgagacagcttctaccgttagttcacgtggc
gtttataaattccctgttgtccgtcgtgcgatgcagaagtatgacgatcatcagtcttca
tcatatgatgtagagcattgcggttggtccaatcttcctgaagacgattttatccagcat
gaggatttgccttattgcattggtgagttcgtatggaccggattcgattatttaggcgaa
ccgactccgtactataccgattggcccagccactcttcgttgtttggaattatagacctt
gccggacttccgaaagaccgttattatctctatcgcagtcattggaataaagataaggaa
acgctgcatatcttgcctcactggaattgggaaggacgtgagggtgaagttaccccggta
tttgtatataccaattatccttcggctgaactgtttattaacggcaaaagtcagggtaag
cgtacaaaggatctctccgttacggtaaacaatagcggtgactctacttctgtggccaac
ttcaaacgtcagcaacgttatcgcctgatgtggatggatacgaaatacgagccgggtact
gtaaaagtggttgcttacgataaagatggcaaagccgttgctgaaaaggaaattcataca
gccggaaagcccgatcacattgagttggtggcagaccgtagcgtgattgacgccaatggt
aaagatctctcatttgtgacagtgaaggtagtcgataaagagggtaatctttgtccgctg
gcagacaatgagatcagtttcaaggtgaagggagcaggtacttatcgtgcaggagccaat
ggtaatccggcttctcttgagtcattccagaccccgaaaatgaaagtattcagcggtatg
atgacagcgattgtgcagtctactgaaaaagcaggaaagatcacacttgaagcaacagga
aaaggtctgaaaaaaggtacattgctgatcgaaagcaaataa

DBGET integrated database retrieval system