KEGG   Bacteroides fragilis NCTC9343: BF2106Help
Entry
BF2106            CDS       T00239                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BF2106 (recR)
DNA repair and recombination proteins [BR:bfs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BF2106 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2462460..2463077
Genome map
AA seq 205 aa AA seqDB search
MNQQYPSTLLEKAVGEFSKLPGIGRKTAMRLVLHLLRQDTSVVEAFGSSIITLKHEVKYC
KVCHNISDTETCQICANPQRDASMVCVVENIRDVMAVEATQQYRGLYHVLGGVISPMDGV
GPGDLQIESLVRRVAEGGINEVILALSTTMEGDTTNFYIYRKLEKMGVKLSVLARGVSIG
DELEYTDEITLGRSIVNRTTFTGTV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaatatccatcgacgttacttgaaaaggccgtcggagagttttctaaattg
ccgggtatcggacggaaaacagctatgagactggtgcttcacctgttgcgtcaggatacc
tctgtggtggaagctttcggaagttctattataactttaaagcatgaggtgaaatattgc
aaggtgtgtcataatatatctgatacggaaacttgtcagatttgtgcaaatccgcagcgg
gacgcgtctatggtctgcgtagtggagaatatacgggatgtgatggccgtagaggccact
caacaatatcgtgggttgtaccatgttttggggggggtgatttcaccgatggatggggta
ggaccgggcgatctgcagatagaaagtctggtgcgccgggtagccgaagggggaataaat
gaagtgattcttgctctaagcacaaccatggaaggggataccacgaatttttatatttac
cgcaaacttgagaaaatgggtgtcaaattgagcgtacttgcccgtggggtatccattggt
gacgagctggaatacacagacgagataacgttgggtagaagtattgtgaaccgtacgact
tttaccggaaccgtttaa

DBGET integrated database retrieval system