KEGG   Bacteroides fragilis NCTC9343: BF2338Help
Entry
BF2338            CDS       T00239                                 

Definition
hydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF2338
Enzymes [BR:bfs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BF2338
Exosome [BR:bfs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BF2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2729357..2731369
Genome map
AA seq 670 aa AA seqDB search
MEKTLNLIKNDPWLEPYKDAIVGRFEHAMDKKAELTNGGKSTLSDFASGYLYFGLHRTDK
GWIFREWAPNASHIYMVGTFSNWEEKPAYKLKRLKNGSWEIKLPIDTIQHGDLYKLHVYW
EGGQGERIPAWANRVVQDDNTKIFSAQVWAPEKPFKFKKKTFKPSTDPLLIYECHIGMAQ
QEEKVGTYNEFREKILPRIAKEGYNCIQIMAIQEHPYYGSFGYHVSSFFAASSRFGTPEE
LKQLIDTAHGLGIAVIMDIVHSHAVKNEVEGLGNFAGDPNQYFYPGGRREHPAWDSLCFD
YGKNEVMHFLLSNCKYWLEEYHFDGFRFDGVTSMLYYSHGLGEAFCNYGDYFNGHQDDNA
ICYLTLANELIHEVNPKAITIAEEVSGMPGLAAKVEDGGYGFDYRMAMNIPDYWIKTIKE
KIDEDWKPSSMFWEVTNRRQDEKTISYAESHDQALVGDKTIIFRLIDADMYWHMQKGDEN
YIVHRGVALHKMIRLLTASTINGGYLNFMGNEFGHPEWIDFPREGNGWSCKYARRQWDLV
DNKNLTYHYLGDFDADMLKVIKSVKNIQQTPVQEIWHNDGDQVLAYQRKDLVFVFNFNPS
QSFTDYGFLVTPGTYEVVLNTDNIIYGGNGLSDDSVKHFTLPDPLYKKEKKEWLKLYIPA
RTAMVLRRTK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagactcttaatcttattaaaaatgatccttggctggaaccttacaaagacgct
atcgttggacgttttgaacatgccatggataagaaggccgaattgaccaatgggggaaaa
tctacgttatcggacttcgcttccggatatctttatttcggtttgcatcgcactgataaa
ggatggatattccgtgagtgggcaccgaatgcatcacatatttatatggtgggtacattc
agtaattgggaagaaaagcctgcttataaactaaaacgcctgaaaaatggtagttgggaa
atcaaattaccgatcgacactatacaacatggtgacttatataaattacacgtctactgg
gaaggcggacagggagaacgaatccctgcttgggccaatcgggtagtacaagatgacaat
acaaaaatattcagtgcccaggtatgggcaccggaaaagccatttaaatttaaaaagaaa
acttttaagcctagtacagatccactgttaatctatgaatgtcatatcggtatggcacag
caggaagaaaaagtcggaacttataatgagtttcgtgaaaaaattctgccgcgtattgcc
aaagagggatacaattgtattcagattatggctatacaggagcacccatattatggtagt
tttggctatcatgtatcgagtttttttgctgcatcgtctcgttttggaactccagaagaa
cttaagcagttgattgataccgcacacggattgggtattgctgtcattatggatatcgtt
cactcacatgcagtaaagaatgaagtagaagggttaggaaactttgcaggtgatccaaat
caatatttctatccaggcggacgaagagaacatccggcatgggattcactttgttttgac
tatggtaaaaatgaagtgatgcattttttactttccaattgtaaatattggttggaagaa
tatcattttgatggcttccgttttgacggggtgacatccatgctttattatagccacgga
ttgggagaagcattttgcaattacggcgactactttaatggacatcaagatgataatgcc
atctgctatctgacattggcaaacgaattgattcatgaagtaaatcctaaggctattacc
attgcagaagaggtttcgggtatgccaggacttgccgccaaggtggaagatggaggatat
ggatttgattatcgtatggctatgaatatccccgattattggatcaagacaattaaagag
aagatagatgaagattggaaaccatccagcatgttttgggaagtaactaaccgtcggcaa
gacgaaaaaacaatttcgtacgctgaaagtcatgatcaggcattggtaggagataaaacg
attattttccgcctgattgatgcagatatgtattggcatatgcagaaaggtgatgaaaat
tatatagttcatcggggcgttgctcttcacaaaatgattcgtttactaactgcaagcacc
attaacggtggatatctgaactttatgggaaatgaattcggacatccggaatggatcgat
tttccgagggaaggtaatggatggtcatgtaagtatgctcgccgccaatgggatttagtc
gataataaaaacttgacttatcattatctgggtgattttgatgcagatatgttgaaagta
attaagagcgtaaaaaacatccagcaaacccctgtacaagaaatatggcacaacgatggc
gaccaagtgttagcgtaccaacgtaaagatcttgtttttgtattcaattttaatccgagt
caatcattcaccgattatggctttttagtaacaccgggaacttatgaggtggtactgaat
acagataacataatttatggaggaaatggcttgtcagatgatagtgtgaagcatttcaca
ttgcccgatcctttgtataagaaagaaaagaaagaatggttgaaactctatattcctgca
cgtacagcaatggtattgagaagaaccaaataa

DBGET integrated database retrieval system