KEGG   Bacteroides fragilis NCTC9343: BF2362Help
Entry
BF2362            CDS       T00239                                 

Gene name
ccp
Definition
cytochrome-C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bfs  Bacteroides fragilis NCTC9343
Brite
Enzymes [BR:bfs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BF2362 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2755986..2757377)
Genome map
AA seq 463 aa AA seqDB search
MKKSTKFIIALLVTVGALAITYRVVNQAPSKDLAADAQMQEIITSGGCLQCHSGSPDLPF
YANWPVASGMVQKDVTQGYRAFDMTEMAEALKAGKPVGKVALAKVEKVIMDGTMPKHAYY
MVHWGSSVTDAKKEMAMAWVKQHRLAHYANGLAAAEFANEPIRPIADSIPVDMRKVILGD
MLYHDTRLSADNTVSCASCHGLNTGGVDNKQYSEGVGGQFGGVNAPTVYNAAYNFVQFWD
GRAGTLAEQAAGPPLNPVEMACQSFDEIIAKLEQDANFTKAFLAVYPDGYSEQNITNAIE
EFEKTLLTPNSRFDLYLKGEKTAINDIELAGYELFKKYDCATCHVGETLGGQSYELMGVK
RDYFADRGIELTEEDNGRFKQTRNERDKHRFKVPGLRNIALTAPYFHDGSMKTMKEAVDY
MAKYQMDLNLPEDELNKIVAFLETLTGEYKGKPLTNDNQTKAL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtacaaaatttatcatcgcattgcttgtgacagtcggggcactggctatc
acttaccgcgttgtaaaccaagcaccgtcgaaagatcttgctgctgatgctcagatgcag
gaaatcattacttcggggggatgtttacaatgtcattcgggcagtccggaccttcctttc
tatgccaactggcccgttgcaagcggaatggtacagaaagacgtaacgcaaggttatcgt
gctttcgacatgaccgaaatggctgaagctctgaaagccggtaagcctgtcggaaaagta
gcacttgctaaagtcgaaaaagtaatcatggacggaacgatgcccaaacatgcttattac
atggtacattggggatcgagcgtaacagatgccaagaaggaaatggctatggcatgggtt
aaacaacatcgcttggcacattatgctaacggactggctgccgccgagtttgccaatgaa
ccgatacgtcctatcgcagattctattcctgtggatatgcgtaaagtcatcttgggagat
atgctctatcatgacactcgcctttcggccgataacaccgtttcatgtgcttcgtgtcac
ggattgaataccggtggtgtggacaataagcaatattcggaaggtgtaggcggacagttc
ggaggcgtaaatgctccgacagtgtataacgccgcttacaatttcgtccagttctgggat
ggacgtgccggaacacttgccgagcaggctgccggacctcctttgaatccggtcgagatg
gcctgtcagtcatttgatgaaatcattgcgaaactggagcaggatgcaaactttaccaaa
gcctttttggctgtatatcccgatggttattccgaacagaatatcacgaatgcgatcgag
gagtttgaaaagacactgcttactccgaattcccgtttcgacctttatctgaaaggtgaa
aagactgccattaacgatatagagctggccggatacgaattgtttaagaaatacgattgt
gctacatgtcatgtcggtgagacactgggcggccagtcttacgaactgatgggcgtaaag
agagactacttcgcagatcgcggcattgaattgacagaagaagataacggacgtttcaaa
caaacccggaacgaacgtgacaaacatcgctttaaagtgcccggtttgagaaacattgcc
ctgacggctccttacttccatgacggcagtatgaaaacaatgaaagaggctgtagattac
atggccaaatatcagatggatctgaatcttccggaagatgaactgaataaaatcgttgct
tttctggagacactgaccggggagtacaaaggtaagcccctgaccaacgataatcagacc
aaagcattataa

DBGET integrated database retrieval system