KEGG   Bacteroides fragilis NCTC9343: BF2385Help
Entry
BF2385            CDS       T00239                                 

Gene name
rfbC2
Definition
LPS biosynthesis dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bfs00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bfs00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2784372..2784920
Genome map
AA seq 182 aa AA seqDB search
MNYIQTEIDGVWIIEPKIFFDPRGYFMEAFKQQEFDATIGQINFIQDNESQSSFGTLRGL
HYQKGAYSQAKLVRVIKGEVLDVAVDLRKSSPTFGKHISVLLSDENKRQLFIPRGFAHGF
LVKSEIAIFTYKVDNIYAPQSEASILYNDPALAIDWPIADSQLVMSEKDKQAGAFREAEY
FE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatacaaacagaaatagatggtgtgtggatcattgaaccgaagatttttttc
gatccgcgcggatatttcatggaagcattcaagcaacaggaatttgatgctactatcgga
cagataaattttatacaagataatgaatctcaatcttcattcggcacgttacgcggactc
cattatcaaaaaggagcctatagccaagccaaactagtgcgtgtcatcaaaggtgaagtg
ctggatgtggctgtcgatttaagaaagtcatcacctacatttggaaagcatatcagcgta
ttgttaagcgacgaaaataaacgccagctttttattccccgtgggtttgcccatggattt
ttagtgaaaagcgaaatagctatctttacttataaggtagataatatatatgccccccaa
tctgaggcttctatcctatacaatgatccggcattggctatcgactggcctattgccgat
tctcaacttgtcatgtcagagaaagacaagcaggcaggagcctttcgggaagcagaatat
tttgaatag

DBGET integrated database retrieval system